DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and MYBPC2

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:NP_004524.3 Gene:MYBPC2 / 4606 HGNCID:7550 Length:1141 Species:Homo sapiens


Alignment Length:534 Identity:139/534 - (26%)
Similarity:220/534 - (41%) Gaps:90/534 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 THPQGGRPKKNVHWKSAERPSPPGRPILTPVALPEQQPDVVNLRWDRPLHDGGSPITGYTVEHRR 74
            |:|. |....::..:..:.|.||....:|.|.     .|...|.|:.|::|||.|:|||.||.::
Human   621 TNPV-GEDVASIFLQVVDVPDPPEAVRITSVG-----EDWAILVWEPPMYDGGKPVTGYLVERKK 679

  Fly    75 MGSPHWVRA-----TPTPVDRCDVCISGLEPGWRYQFRCFAENIVGRSDASELSDPLTVTLQRNA 134
            .||..|::.     |.|..:...: |.|:    .|:.|.||.|.:|.|..|..:.|. :.:...:
Human   680 KGSQRWMKLNFEVFTETTYESTKM-IEGI----LYEMRVFAVNAIGVSQPSMNTKPF-MPIAPTS 738

  Fly   135 ITVPRFIDELVDTNAVEDERIEFRVRILGEPPPEINWFKDGYEIFSSRRTKIVNDNEASVLVIHQ 199
            ..:...::::.||......|...|:...|.....:.:..:|.|.:....|:.|   |.....:..
Human   739 EPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPV---ERCGFTVKN 800

  Fly   200 VALTDEGEIKCTATNRAG--HVITKARLM----VQAPPKIRLPRTYEDGLIVEADEVLRLKVGVA 258
            :........:....|.||  ...|.|:.:    :..||||||||......|.:..|.|.|.|...
Human   801 LPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQ 865

  Fly   259 GQPPPAITWLHEGEVIAP--GGRFEVSNTEKNSLLKIDNVLREDRGEYMVKAWNRLGEDSTSFLV 321
            |:|.|.:.|...|   ||  ..|..|..::.:::..:....|.|.|||.:.......:|:.:..:
Human   866 GKPRPQVVWTKGG---APLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRI 927

  Fly   322 TVTARPNPPGTPKLNMSFGKSATLSWTAPLDDGGCKIGNYIV--------EYFRVGWNVWLKAAT 378
            .|..:..||....:...:|.:|.:.|.||.|||..:|..|.|        |:|    ||:.:   
Human   928 RVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWF----NVYER--- 985

  Fly   379 TRALSTTLHDLIEGSEYKFRVKAENPYGLSEPSGESE----LLFIPDPKRGIT-KPKSATRIAGD 438
            .|..|.|:.|||.|:||.|||..||..|||:..|.|:    :|     |.||| ||     ....
Human   986 NRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARIL-----KTGITFKP-----FEYK 1040

  Fly   439 EKDKPKTGAGGMQVPPRRKTLSPPRPQAD--ASTGMSPKQSPSAKRKPKPQLIDNEQLTHEMSYG 501
            |.|        .::.|:..|     |..|  ...|.|...:.:.:..|||:::..:.        
Human  1041 EHD--------FRMAPKFLT-----PLIDRVVVAGYSAALNCAVRGHPKPKVVWMKN-------- 1084

  Fly   502 TSDHALKMDVRKSP 515
                  ||::|:.|
Human  1085 ------KMEIREDP 1092

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020 34/102 (33%)
I-set 138..227 CDD:254352 15/94 (16%)
Ig 155..224 CDD:143165 11/70 (16%)
IG_like 243..323 CDD:214653 20/81 (25%)
Ig 250..323 CDD:299845 18/74 (24%)
FN3 327..411 CDD:238020 34/91 (37%)
MYBPC2NP_004524.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
IG_like 58..153 CDD:214653
I-set 258..342 CDD:254352
Ig 283..330 CDD:299845
I-set 348..434 CDD:254352
Ig 374..441 CDD:143165
IG_like 447..>509 CDD:214653
Ig 456..>509 CDD:143165
Ig_C5_MyBP-C 550..635 CDD:143302 3/14 (21%)
IG_like 554..635 CDD:214653 3/14 (21%)
FN3 639..725 CDD:238020 32/95 (34%)
FN3 738..830 CDD:238020 15/94 (16%)
IG_like 848..929 CDD:214653 20/83 (24%)
Ig_Titin_like 857..929 CDD:143225 18/74 (24%)
FN3 934..1016 CDD:238020 33/88 (38%)
I-set 1048..1137 CDD:254352 13/64 (20%)
Ig 1067..1132 CDD:143165 7/40 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000709
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X825
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.