DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and AgaP_AGAP010633

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:XP_001230579.2 Gene:AgaP_AGAP010633 / 4577713 VectorBaseID:AGAP010633 Length:322 Species:Anopheles gambiae


Alignment Length:436 Identity:78/436 - (17%)
Similarity:137/436 - (31%) Gaps:152/436 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   688 ISAPPTPQEEEPPVLERSPSPEPAPKSQSNARRFSRSADKHDDVHTSNEFMLVVFDKNSKVKDKD 752
            ::.|.||    .|.||.....| :.||:.|..|.||:.:|.:::....:|:         ..|..
Mosquito     4 VTTPTTP----APALELDSELE-SLKSKVNTIRTSRAQNKLNELAQRPDFL---------ANDPF 54

  Fly   753 KQDSFELDLEDAIQPPPISISAPDLAFLEFTNLHTTFPLRRSVSSTELLYERAMARFYEAVELEQ 817
            |..:|.      ..|..||:...|..|.|              :.|:.....|..|      |.:
Mosquito    55 KLPTFR------FLPKSISLCNEDSVFKE--------------NYTKFCDRNASGR------LSR 93

  Fly   818 ASKSRKTSRDKLVTPVPHQTPANLRKRLGSISEAERLSFERRSEMRRQSADVVSISRKWDSRENV 882
            ......|..:|:.|             :|:|             :|::|....:..:|.|.....
Mosquito    94 EQSQETTVSEKIDT-------------VGTI-------------VRKKSTTSSTTKKKKDPEGAA 132

  Fly   883 NEMGNLTRIHTTGQLP---FETRKDLRESEAEEEHEEGEEEHLTESTADDSEDMDLDYDEDLDVD 944
            ......|...|....|   ..:...:|::..:::          :...:|:....||.       
Mosquito   133 TATTTTTTTTTFSSTPSGKIASTTTVRKTIVKQQ----------KIVVEDASSSSLDV------- 180

  Fly   945 YPPQKKLQQQSSNDLGSDYTESTASSEQDSIEKFKMELLARTRSPSPRDLETYHPRTMGAGTFTP 1009
                      ||:....|.::.|.|:   ||::.|.    |....|.||:               
Mosquito   181 ----------SSSSTALDSSKLTHSA---SIKRTKF----RVNQLSSRDV--------------- 213

  Fly  1010 YRAPTPEQAAVVLNRPVPLPSPDFVPKPILKRSS-NEHMEQAVSPLPSSFASEAP-TIIVPPTAT 1072
                           ||.:.|   |.:..|:||. .:.:..:.:.||.:.:...| ...:..|.|
Mosquito   214 ---------------PVAINS---VARRYLERSGIQDDLSTSAARLPRTLSPTGPGQTTLDDTVT 260

  Fly  1073 VANSNPSTLKMDLAKGIKSFFSRDKRSATEKNTEANEEISNPLERT 1118
            |.|...|.|::              ||:...:.:|.|.:.|...:|
Mosquito   261 VNNLRNSALRL--------------RSSVSVDWDAMEAVENRSMKT 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020
I-set 138..227 CDD:254352
Ig 155..224 CDD:143165
IG_like 243..323 CDD:214653
Ig 250..323 CDD:299845
FN3 327..411 CDD:238020
AgaP_AGAP010633XP_001230579.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0613
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.