DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and Egflam

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:XP_006232075.1 Gene:Egflam / 365691 RGDID:1306592 Length:1013 Species:Rattus norvegicus


Alignment Length:293 Identity:67/293 - (22%)
Similarity:107/293 - (36%) Gaps:90/293 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 EVIA---PGGRFEVSNTEKNSLLKIDNVLREDRGEYMVKAWNRLGEDSTSFLVTVTA-------R 326
            |||.   ||..:.||                      :.|:::.|:...||...||.       .
  Rat    99 EVIGDLKPGTEYRVS----------------------IAAYSQTGKGRLSFPRHVTTLSQDSCLP 141

  Fly   327 PNPPGTPKLNMSFGKSATLSWTAPLDDGGCKIGNYIVEYFR----VGWNVWLKAATTRALSTTLH 387
            |..|..|.:.:.......|||....::|...|.:|.||:.|    ..|.:..:  ..:..|..:.
  Rat   142 PEAPHQPHVLVVSDSEVALSWRPGENEGSAPIQSYSVEFIRPDFDKSWTIIQE--RLQMDSMVIK 204

  Fly   388 DLIEGSEYKFRVKAENPYGL---SEPSGESELL-------------FIPDPKRGIT--------- 427
            .|...:.|:|.|:|.|.||.   |:||.....|             :|.|  .|::         
  Rat   205 GLDPDTNYQFAVRAMNAYGFSLRSQPSNTIRTLGPGEAGSGRYGPGYITD--TGVSEDDDASEDE 267

  Fly   428 ----------KPKSATRIAGDEKDKPKTGAGGMQVPPRRKTLSPPRPQADASTGMSPKQSPSAKR 482
                      ||..||:: |::|.| ||.....::..|   |:.|...:...|.::...:| |:|
  Rat   268 LDLDVSFEEVKPLPATKV-GNKKSK-KTSVSNSEMDSR---LAQPTSASLPETTVAVPPTP-AQR 326

  Fly   483 KPK------PQLID---NEQLTHEMSYGTSDHA 506
            |.|      .:|.|   :|.|....|:..:|:|
  Rat   327 KGKNSVAVMSRLFDMSCDETLCSADSFCVNDYA 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020
I-set 138..227 CDD:254352
Ig 155..224 CDD:143165
IG_like 243..323 CDD:214653 11/53 (21%)
Ig 250..323 CDD:299845 11/53 (21%)
FN3 327..411 CDD:238020 23/90 (26%)
EgflamXP_006232075.1 FN3 36..133 CDD:238020 12/55 (22%)
FN3 142..236 CDD:238020 25/95 (26%)
LamG 387..537 CDD:238058
EGF_CA 556..598 CDD:238011
Laminin_G_2 637..763 CDD:280389
EGF_CA 786..816 CDD:238011
Laminin_G_2 864..989 CDD:280389
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0613
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.