DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MnM and Obsl1

DIOPT Version :10

Sequence 1:NP_647779.2 Gene:MnM / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:XP_343600.4 Gene:Obsl1 / 363259 RGDID:1306073 Length:1897 Species:Rattus norvegicus


Alignment Length:1687 Identity:321/1687 - (19%)
Similarity:515/1687 - (30%) Gaps:618/1687 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GGRPKKNVHWKSAERPSPPGRPILTPVALPE-QQPDVVNLRWDRPLHDGGSPITGYTVEHRRMGS 77
            ||.|:..::|:.            ..:||.| .......|..||...|||:.:|...:..|...|
  Rat   152 GGLPEPKLYWEK------------DGMALDEVWDSSHYTLEPDRGASDGGASLTLRILAARLPDS 204

  Fly    78 PHWVRATPTPVDRCDVCISGLEPGWRYQFRCFAENIVGRSDASEL-----------SDPLTVTLQ 131
            ..:|                          |.|.|..|.:.|..|           .||....: 
  Rat   205 GVYV--------------------------CHARNAHGHAQAGALLQVHQPHENPPQDPDEPPV- 242

  Fly   132 RNAITVPRFIDELVDTNAV----EDERIEFRVRILGEPPPEINWFKDGYEIFSSRRTKIVNDNEA 192
                   |.|:.|......    |.:..:||..::|:|.|||.|..:|..:...||..:..|.:.
  Rat   243 -------RVIEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHLEGRPLLPDRRRLMYRDRDG 300

  Fly   193 S-VLVIHQVALTDEGEIKCTATNRAGHVITKARLMVQAPPKIRLPRTYEDGLIVEADE----VLR 252
            . ||.:......|.|...|.|.|.||..::..:|.|: .|::|..|..:|   ||..|    ||.
  Rat   301 GFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVK-EPRLRFTRPLQD---VEGREHGIVVLE 361

  Fly   253 LKVGVAGQPPPAITWLHEGEVIAPGGRFE---------------------------------VSN 284
            .||..:..|   ..|..|.:.:.|..::|                                 |:|
  Rat   362 CKVPNSRIP---TAWFREDQRLLPCRKYEQIEEGTVRRLVIHRLKADDDGVYLCEMRGRVRTVAN 423

  Fly   285 -TEKNSLLK---------------------------------------------------IDNVL 297
             |.|..:||                                                   :..|.
  Rat   424 VTVKGPILKRLPRKLDVLEGENAVLLVETQEAGVQGCWSRDGEELPATCQSSCGHMHALVLPGVT 488

  Fly   298 REDRGEYMVKAWNRLGEDSTSFLVTV-TARPNPPGTPKL-NMSFGKSAT--LSWTAPLDDGGCKI 358
            |||.||....    ||...|:.|:.| ..:.:|||.|.| .|..|:..|  |:|..|........
  Rat   489 REDAGEVTFS----LGNSRTTTLLRVKCVKHSPPGPPVLVEMFKGQKNTVLLTWKPPEPPPETSF 549

  Fly   359 GNYIVEYFRVGWNVWL------KAATTRALSTTLHDLI--EGSEYKFRVKAENPYGLSEP---SG 412
             .|.:|...||...|:      ||.......    |.:  || :|:||:...:.:|.|..   :|
  Rat   550 -IYRLERQEVGSEDWIQCFSIEKAGAVEVPG----DCVPTEG-DYRFRICTVSEHGRSPHVVFNG 608

  Fly   413 ESELLFIP--------------DPKRGITKPKSATRIAG-----------DEKD-KPKTGA---- 447
            .:.|  :|              |.:..:.....:|.|.|           ||.: :.:.||    
  Rat   609 SAHL--VPTARLVSGLEDVQVYDGEDAVFSLDLSTIIQGSWFLNGELLKNDEAEGQVEPGALRYR 671

  Fly   448 ---GGMQVPPRRKTLSPPR------------PQADASTGMSPKQSPSAKRKPKPQLI------DN 491
               .|:|   .|..|...:            |....|..:|.::||.....|:.:::      :.
  Rat   672 IEQKGLQ---HRLILQTVKHQDNGALVGFICPGVQDSAALSIQESPVHILSPQDKVLLTFTTSER 733

  Fly   492 EQLTHEMS---------------YGTSDHALKMDVRKS----PSLNSADSAN-KPTTDSSNPKLN 536
            ..||.|:|               ..:....:|||.||.    |.....||.. :..|:..:...:
  Rat   734 VVLTCELSRVDFPATWYKDGQKVEESESLVVKMDGRKHRLILPEAQVRDSGEFECRTEGISAFFS 798

  Fly   537 LTLVTTTLAPLDKSVPSPKAPRTPATSPLKLFNPKPS---GAPKDRSPVQPKPQPLPTPPMETPD 598
            :|            |..|         |:.:.:|:..   .|....|       .:.|..::..|
  Rat   799 VT------------VQDP---------PVHIVDPQEHVFVHAITSES-------VMLTCEVDRED 835

  Fly   599 ------KASPNPKRSLSPPNKRQPPPLRKSPTPPEPIKVTPALLRSAEPVQLGVNQNVRRFSGQT 657
                  |.....:.|.....:::.|..|             .:|.:|:|...|..|.|       
  Rat   836 AAVHWYKDGQEVEESAVIVLEKEGPRHR-------------LVLPAAQPSDGGEFQCV------- 880

  Fly   658 LSPARNVPTLALAVASG----------VSAVIGEKLP-TIEISAP-----PTPQEEEPPVLERSP 706
            :...|...|:.:...|.          |:||..|::. |.|:..|     .|...||  |||   
  Rat   881 VGDERAYFTVTITDVSSWIVYPNGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEE--VLE--- 940

  Fly   707 SPEPAPKSQSNARRFSRSADKHDDVHTSNEFMLVVFDKNSKVKDKDKQDSFELDLEDAIQPPPIS 771
            ||....:.:...||....:.:.:|   |.|::..:.|:::         ||.:    .:..||:.
  Rat   941 SPALLLEKEDTIRRLVLPSVQLED---SGEYLCEIHDESA---------SFTI----TVTEPPVR 989

  Fly   772 ISAPDLAFLEFTNLHTTFPLRRSVSSTELLYERAMARFYEAVELEQASKSRKTSRDKLVTPVPHQ 836
            |..|.    :...||.. .|...|.:.||....|..|:|               :|.|       
  Rat   990 IIYPQ----DEVTLHAV-SLECVVLTCELSRVDAPVRWY---------------KDGL------- 1027

  Fly   837 TPANLRKRLGSISEAERLSFERRSEMRRQSADVVSISRKWDSRENVNEMGNLTRIHT-TGQLPFE 900
                      .:.|.|.|..:.....||.   |:..::..|..|.|.:.|:.:...| |...|  
  Rat  1028 ----------EVEETEALVLQSDGPRRRL---VLPAAQPEDGGEFVCDAGDDSAFFTVTVTAP-- 1077

  Fly   901 TRKDLRESEAEEEHEEGEEEHLTESTADDSEDMDLDYDEDLDVDYPPQKKLQQQSSNDLGSDYTE 965
                              .|.:....|   ..:||.:..      |...:|:.:          .
  Rat  1078 ------------------PERIVHPVA---RSLDLQFGA------PGHVELRCE----------V 1105

  Fly   966 STASSE----QDSIEKFKMELLARTRSPSPRDLETYHPRTMGAGTFTPYRAPTPEQAAV----VL 1022
            :.|.|:    :|.:|....:.|........|.|...|.:...||   .|...|.::|..    :.
  Rat  1106 APAGSQVRWYKDGLEVEVSDALQLGAEGPARTLTLPHAQPEDAG---EYVCETRDEAVTFNVSLA 1167

  Fly  1023 NRPVPLPSPDFVPKPILKRSSNEHMEQAVSPLPSSFASEAPTIIVPPTATVANSNPSTLKMDLAK 1087
            ..||...:|:.||.|:                          .:||       ..|..|..:|: 
  Rat  1168 ELPVQFLAPEAVPNPL--------------------------CVVP-------GEPVMLSCELS- 1198

  Fly  1088 GIKSFFSRDKRSATEKNTEANEEISNPLERTNAAAIAADLEVKRKAKEEEELRRKEEERLMQEEA 1152
                      |::...:...|   .||:                |..|..|||.:...|::..:|
  Rat  1199 ----------RASAHVSWSHN---GNPV----------------KQGEGLELRAEGPRRILCIQA 1234

  Fly  1153 HAAVDHYSDLVKEVGSSHKYHTPLYLDRDELKRAAAKAA-----AETDEEDMLTHAEELKKRRAT 1212
                   :||.         ||.:|..:......|...:     ||.....:...|.:.:.|...
  Rat  1235 -------ADLA---------HTGVYTCQSGTAPGAPSLSFNVQVAEPPVRVVAPEAAQTRVRSTP 1283

  Fly  1213 GGSEDL--FLAPP------------VVRERRLSISE--REQLVHVRDAASSLAFHRSPEKPESDQ 1261
            ||..:|  .|:.|            :..:.|:.:.:  ..|::.||.|....|           .
  Rat  1284 GGDLELVVHLSRPGGPVRWYKDGERLASQGRVQLEQAGERQVLRVRGARRGDA-----------G 1337

  Fly  1262 EHESPKSQQD-------EEPEYPTVLVVPPPKSKNKNESETESVMSEMVEARPDARGRTRLVKVK 1319
            |:....||..       |||  |.|.:|........:|.:..:...|:  :.|||          
  Rat  1338 EYLCDASQDSRIFIVSVEEP--PPVKLVSELTPLTVHEGDDATFQCEV--SPPDA---------- 1388

  Fly  1320 RVIRRRVPSSTRSRDASLTRPAIAEVEGSQQTSLVLSAADRDL------LQKAATLAIL--QSEE 1376
                    ..|..|:.::..|       ..|..:|.|.:.|.|      |:.|.|:...  .::.
  Rat  1389 --------EVTWLRNGAIVTP-------GPQLEMVHSGSSRTLIIRGCQLKDAGTVTARAGATDT 1438

  Fly  1377 QAHEKVRSALSYCTDLVLFLVACYVYLFKDARLVLPILGLIIYRQLGEAVRGYVPG---WLR 1435
            .|...||.     |:|:      ::...:|.|..   .|..:|.:: |..|...||   |||
  Rat  1439 SARLHVRE-----TELL------FLRRLQDVRAE---EGQDVYLEV-ETGRVGAPGAVRWLR 1485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MnMNP_647779.2 FN3 29..127 CDD:238020 21/109 (19%)
I-set 138..227 CDD:400151 26/93 (28%)
Ig strand B 155..159 CDD:409565 1/3 (33%)
Ig strand C 168..172 CDD:409565 2/3 (67%)
Ig strand E 194..197 CDD:409565 2/2 (100%)
Ig strand F 207..212 CDD:409565 1/4 (25%)
Ig strand G 220..223 CDD:409565 0/2 (0%)
Ig 243..323 CDD:472250 28/168 (17%)
Ig strand B 251..255 CDD:409353 1/3 (33%)
Ig strand C 264..268 CDD:409353 0/3 (0%)
Ig strand E 289..293 CDD:409353 2/54 (4%)
Ig strand F 303..308 CDD:409353 1/4 (25%)
Ig strand G 316..319 CDD:409353 1/2 (50%)
FN3 327..411 CDD:238020 26/97 (27%)
PHA03247 <420..718 CDD:223021 69/393 (18%)
Obsl1XP_343600.4 I-set 12..88 CDD:400151
Ig strand B 29..33 CDD:409353
Ig strand C 42..46 CDD:409353
Ig strand E 67..71 CDD:409353
Ig strand F 81..86 CDD:409353
IG_like 134..226 CDD:214653 23/111 (21%)
Ig strand B 145..149 CDD:409353
Ig strand C 158..162 CDD:409353 0/3 (0%)
Ig strand E 186..196 CDD:409353 4/9 (44%)
Ig strand F 206..211 CDD:409353 2/30 (7%)
Ig strand G 219..222 CDD:409353 1/2 (50%)
Ig 257..336 CDD:472250 23/78 (29%)
Ig strand B 263..267 CDD:409353 1/3 (33%)
Ig strand C 276..280 CDD:409353 2/3 (67%)
Ig strand E 302..306 CDD:409353 2/3 (67%)
Ig strand F 316..321 CDD:409353 1/4 (25%)
Ig strand G 329..332 CDD:409353 0/2 (0%)
Ig 342..426 CDD:472250 17/89 (19%)
Ig strand B 358..362 CDD:409353 2/3 (67%)
Ig strand C 371..374 CDD:409353 0/2 (0%)
Ig strand E 395..399 CDD:409353 0/3 (0%)
Ig strand F 409..414 CDD:409353 0/4 (0%)
Ig strand G 423..426 CDD:409353 1/2 (50%)
FN3 518..602 CDD:238020 24/89 (27%)
Ig 736..801 CDD:472250 14/76 (18%)
Ig strand C 746..750 CDD:409353 0/3 (0%)
Ig strand E 771..775 CDD:409353 0/3 (0%)
Ig strand F 785..790 CDD:409353 0/4 (0%)
Ig strand G 794..797 CDD:409353 0/2 (0%)
Ig 817..892 CDD:472250 16/101 (16%)
Ig strand B 825..829 CDD:409353 0/3 (0%)
Ig strand C 837..841 CDD:409353 0/3 (0%)
Ig strand E 862..866 CDD:409353 1/16 (6%)
Ig strand F 876..881 CDD:409353 2/11 (18%)
Ig strand G 885..888 CDD:409353 1/2 (50%)
Ig 918..983 CDD:472250 19/85 (22%)
Ig strand C 928..932 CDD:409353 0/3 (0%)
Ig strand E 953..957 CDD:409353 2/3 (67%)
Ig strand F 967..972 CDD:409353 1/4 (25%)
Ig strand G 976..979 CDD:409353 0/11 (0%)
Ig 1009..1074 CDD:472250 18/99 (18%)
Ig strand C 1019..1023 CDD:409353 1/3 (33%)
Ig strand E 1044..1048 CDD:409353 2/6 (33%)
Ig strand F 1058..1063 CDD:409353 2/4 (50%)
Ig strand G 1067..1070 CDD:409353 0/2 (0%)
Ig 1096..1166 CDD:472250 15/82 (18%)
Ig strand B 1099..1103 CDD:409353 1/3 (33%)
Ig strand C 1111..1115 CDD:409353 0/3 (0%)
Ig strand E 1136..1140 CDD:409353 2/3 (67%)
Ig strand F 1150..1155 CDD:409353 1/4 (25%)
Ig strand G 1159..1162 CDD:409353 1/2 (50%)
Ig 1180..1265 CDD:472250 25/163 (15%)
Ig strand B 1191..1195 CDD:409353 1/3 (33%)
Ig strand C 1203..1207 CDD:409353 0/3 (0%)
Ig strand E 1228..1232 CDD:409353 1/3 (33%)
Ig strand F 1242..1247 CDD:409353 1/4 (25%)
Ig strand G 1258..1261 CDD:409353 0/2 (0%)
Ig 1273..1354 CDD:472250 16/91 (18%)
Ig strand B 1287..1291 CDD:409353 1/3 (33%)
Ig strand C 1299..1303 CDD:409353 0/3 (0%)
Ig strand E 1324..1328 CDD:409353 1/3 (33%)
Ig strand F 1338..1343 CDD:409353 1/4 (25%)
Ig strand G 1347..1350 CDD:409353 0/2 (0%)
Ig 1361..1444 CDD:472250 18/109 (17%)
Ig strand B 1377..1381 CDD:409353 0/3 (0%)
Ig strand C 1389..1393 CDD:409353 1/3 (33%)
Ig strand E 1414..1418 CDD:409353 2/3 (67%)
Ig strand G 1437..1440 CDD:409353 0/2 (0%)
Ig 1451..1522 CDD:472250 11/39 (28%)
Ig strand B 1466..1470 CDD:409353 1/3 (33%)
Ig strand C 1478..1484 CDD:409353 2/5 (40%)
Ig strand E 1505..1509 CDD:409353
Ig strand F 1519..1524 CDD:409353
Ig strand G 1528..1531 CDD:409353
Ig 1543..1624 CDD:472250
Ig strand B 1557..1561 CDD:409353
Ig strand C 1569..1573 CDD:409353
Ig strand E 1594..1598 CDD:409353
Ig strand F 1608..1613 CDD:409353
Ig strand G 1617..1620 CDD:409353
Ig 1639..1706 CDD:472250
Ig strand B 1646..1650 CDD:409353
Ig strand C 1658..1662 CDD:409353
Ig strand E 1683..1687 CDD:409353
Ig strand F 1697..1702 CDD:409353
Ig 1720..1803 CDD:472250
Ig strand B 1736..1740 CDD:409353
Ig strand C 1749..1752 CDD:409353
Ig strand E 1773..1777 CDD:409353
Ig strand G 1796..1799 CDD:409353
IG_like 1815..1893 CDD:214653
Ig strand B 1826..1830 CDD:409353
Ig strand C 1838..1842 CDD:409353
Ig strand E 1863..1867 CDD:409353
Ig strand F 1877..1882 CDD:409353
Ig strand G 1886..1889 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.