DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and Mybpc1

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:XP_008763468.1 Gene:Mybpc1 / 362867 RGDID:735102 Length:1196 Species:Rattus norvegicus


Alignment Length:542 Identity:140/542 - (25%)
Similarity:216/542 - (39%) Gaps:122/542 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NQPGKLHTHPQGGRPKKNVHWKSAERPSPPGRPILTPVALPEQQPDVVNLRWDRPLHDGGSPITG 67
            |:.|:.|.         ::..|..:.|.||..|.:|.|.     .|...:.|:.|::||||||.|
  Rat   629 NEAGEAHA---------SIKIKVVDIPDPPVAPNVTEVG-----DDWCIMNWEPPVYDGGSPILG 679

  Fly    68 YTVEHRRMGSPHWVRATPTPVDRCDVC-ISGLEP-----GWRYQFRCFAENIVGRSDASELSDPL 126
            |.:|.::..|..|:|.      ..|:| .:..||     |..|:.|.||.|.:|.|..|..|.|.
  Rat   680 YFIERKKKQSSRWMRL------NFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSKPF 738

  Fly   127 TVTLQRNAITVPRFIDELVDTNAVEDERIEFRVRILGEPPPEINWF-KDGYEI----FSSRRTKI 186
             |.|   |:|.|   ..|:..::|.|..:..:.|    ||.:|... .|||.:    ..|...|.
  Rat   739 -VPL---AVTSP---PTLLAVDSVTDSSVTMKWR----PPDQIGAAGLDGYVLEYCFEGSTSAKQ 792

  Fly   187 VNDN-------------EASVLVIHQVALTDEG-------EIKCTATNRAG---------HVITK 222
            .|:|             .|:..:|.:...|..|       .::..|.|.||         .::.|
  Rat   793 SNENGEAAYDLPAEDWITANTDLIDKTKFTITGLPTDAKIFVRVKAINAAGASEPKYYSQPILVK 857

  Fly   223 ARLMVQAPPKIRLPRTYEDGLIVEADEVLRLKVGVAGQPPPAITWLHEGEVIAPGGRFEVSNTEK 287
            .   :..|||||:||..:...|....|.:.|.:...|:|.|.:||..:|..| ...:..:.|:|.
  Rat   858 E---IIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSET 918

  Fly   288 NSLLKIDNVLREDRGEYMVKAWNRLGEDSTSFLVTVTARPNPPGTPKLNMSFGKSATLSWTAPLD 352
            ::::.|....|...|:|.::.......::.|..:.:..||.||....:...:|::..|:||.|.|
  Rat   919 DTIIFIRKAERSHSGKYDLEVKVDKYVENASIDIQIVDRPGPPQAVTIEDVWGENVALTWTPPKD 983

  Fly   353 DGGCKIGNYIV--------EYFRVGWNVWLKAATTRALSTTLHDLIEGSEYKFRVKAENPYGLSE 409
            ||...|..|.:        |:|.|       .......:.|:.:|:.|:||.|||.|||..||||
  Rat   984 DGNAAITGYTIQKADKKSMEWFTV-------IEHYHRTNATITELVIGNEYYFRVFAENMCGLSE 1041

  Fly   410 PSGESELLFIPDPKRGITKPKSATRIAGDEK--------DKPKTGAGGMQVPPRRKTLSPPRPQA 466
            .:               |..|.:..||.|.|        |...|.|         ...:.|....
  Rat  1042 DA---------------TMTKESAVIAKDGKIYKNPVYEDFDFTEA---------PMFTQPLVNT 1082

  Fly   467 DASTGMSPKQSPSAKRKPKPQL 488
            .|..|.:...:.|.:..|||::
  Rat  1083 YAIAGYNATLNCSVRGNPKPKI 1104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020 36/103 (35%)
I-set 138..227 CDD:254352 24/122 (20%)
Ig 155..224 CDD:143165 20/102 (20%)
IG_like 243..323 CDD:214653 17/79 (22%)
Ig 250..323 CDD:299845 15/72 (21%)
FN3 327..411 CDD:238020 31/91 (34%)
Mybpc1XP_008763468.1 IG_like 90..185 CDD:214653
ig 90..174 CDD:278476
I-set 280..363 CDD:254352
Ig 305..364 CDD:299845
I-set 370..454 CDD:254352
Ig <399..454 CDD:299845
IG_like 467..545 CDD:214653
Ig_C5_MyBP-C 557..642 CDD:143302 3/21 (14%)
IG_like 560..642 CDD:214653 3/21 (14%)
FN3 646..735 CDD:238020 34/99 (34%)
FN3 745..847 CDD:238020 23/108 (21%)
IG_like 873..954 CDD:214653 17/81 (21%)
Ig 883..>940 CDD:299845 14/57 (25%)
FN3 958..1041 CDD:238020 29/89 (33%)
I-set 1073..1162 CDD:254352 7/32 (22%)
Ig 1090..1155 CDD:143165 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000709
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X825
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.