DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MnM and MYBPHL

DIOPT Version :10

Sequence 1:NP_647779.2 Gene:MnM / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:NP_001010985.2 Gene:MYBPHL / 343263 HGNCID:30434 Length:354 Species:Homo sapiens


Alignment Length:305 Identity:86/305 - (28%)
Similarity:129/305 - (42%) Gaps:62/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 VQAPPKIRLPRTYEDGLIVEADEVLRLKVGVAGQPPPAITWLHEGEVIAPGGRFEVSNTEKNSLL 291
            ::..|||.|||......|.:..:.:.|.:...|:|.|...|.|:|..: ...|..|.|.|::|:|
Human    47 I
EEHPKIWLPRALRQTYIRKVGDTVNLLIPFQGKPKPQAIWTHDGCAL-DTRRVSVRNGEQDSIL 110

  Fly   292 KIDNVLREDRGEYMVKAWNRLG--EDSTSFLVTVTARPNPPGTPKLNMSFGKSATLSWTAPLDDG 354
            .|....|.|.|.|.::.  :||  |.:.:..:.|..||.||.:.||...:|.||||.||.|.|.|
Human   111 FIREAQRADSGRYQLRV--QLGGLEATATIDILV
IERPGPPQSIKLVDVWGFSATLEWTPPQDTG 173

  Fly   355 GCKIGNYIVEYFRVGWNVWLKAATTRAL-----------STTLHDLIEGSEYKFRVKAENPYGLS 408
            ...:..|.|:          ||.|...|           |..:.|||.|:.|.|||.|||..|||
Human   174 NTALLGYTVQ----------KADTKSGLWFTVLEHYHRTSCIVSDLIIGNSYAFRVFAENQCGLS 228

  Fly   409 EPSG-ESELLFIPDPKRGITKPKSATRIAGDEKDKPKTGAGGMQVPPRRKTLSPPRPQADAS--T 470
            |.:. .::|..|   ::..|..|:......|..:.||.                .:|.||.:  |
Human   229 ETAPITT
DLAHI---QKAATVYKTKGFAQRDFSEAPKF----------------TQPLADCTTVT 274

  Fly   471 GMSPKQSPSAKRKPKPQLIDNEQLTHEMSYGTSDHALKMDVRKSP 515
            |.:.:.....:..|:|::|..:.              |||::.:|
Human   275 GYNTQLFCCVRASPRPKIIWLKN--------------KMDIQGNP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MnMNP_647779.2 FN3 29..127 CDD:238020
I-set 138..227 CDD:400151 86/305 (28%)
Ig strand B 155..159 CDD:409565
Ig strand C 168..172 CDD:409565
Ig strand E 194..197 CDD:409565
Ig strand F 207..212 CDD:409565
Ig strand G 220..223 CDD:409565
Ig 243..323 CDD:472250 22/81 (27%)
Ig strand B 251..255 CDD:409353 1/3 (33%)
Ig strand C 264..268 CDD:409353 0/3 (0%)
Ig strand E 289..293 CDD:409353 2/3 (67%)
Ig strand F 303..308 CDD:409353 1/4 (25%)
Ig strand G 316..319 CDD:409353 0/2 (0%)
FN3 327..411 CDD:238020 37/94 (39%)
PHA03247 <420..718 CDD:223021 17/98 (17%)
MYBPHLNP_001010985.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47 86/305 (28%)
Ig 62..142 CDD:472250 22/82 (27%)
Ig strand B 71..75 CDD:409406 1/3 (33%)
Ig strand C 84..88 CDD:409406 0/3 (0%)
Ig strand E 108..112 CDD:409406 2/3 (67%)
Ig strand F 122..127 CDD:409406 1/4 (25%)
Ig strand G 135..138 CDD:409406 0/2 (0%)
FN3 146..235 CDD:238020 37/98 (38%)
Ig 261..350 CDD:472250 14/75 (19%)
Ig strand B 278..282 CDD:409353 0/3 (0%)
Ig strand C 291..295 CDD:409353 1/3 (33%)
Ig strand E 316..320 CDD:409353
Ig strand F 330..335 CDD:409353
Ig strand G 343..346 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.