DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and MYBPHL

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:NP_001010985.2 Gene:MYBPHL / 343263 HGNCID:30434 Length:354 Species:Homo sapiens


Alignment Length:305 Identity:86/305 - (28%)
Similarity:129/305 - (42%) Gaps:62/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 VQAPPKIRLPRTYEDGLIVEADEVLRLKVGVAGQPPPAITWLHEGEVIAPGGRFEVSNTEKNSLL 291
            ::..|||.|||......|.:..:.:.|.:...|:|.|...|.|:|..: ...|..|.|.|::|:|
Human    47 I
EEHPKIWLPRALRQTYIRKVGDTVNLLIPFQGKPKPQAIWTHDGCAL-DTRRVSVRNGEQDSIL 110

  Fly   292 KIDNVLREDRGEYMVKAWNRLG--EDSTSFLVTVTARPNPPGTPKLNMSFGKSATLSWTAPLDDG 354
            .|....|.|.|.|.::.  :||  |.:.:..:.|..||.||.:.||...:|.||||.||.|.|.|
Human   111 FIREAQRADSGRYQLRV--QLGGLEATATIDILV
IERPGPPQSIKLVDVWGFSATLEWTPPQDTG 173

  Fly   355 GCKIGNYIVEYFRVGWNVWLKAATTRAL-----------STTLHDLIEGSEYKFRVKAENPYGLS 408
            ...:..|.|:          ||.|...|           |..:.|||.|:.|.|||.|||..|||
Human   174 NTALLGYTVQ----------KADTKSGLWFTVLEHYHRTSCIVSDLIIGNSYAFRVFAENQCGLS 228

  Fly   409 EPSG-ESELLFIPDPKRGITKPKSATRIAGDEKDKPKTGAGGMQVPPRRKTLSPPRPQADAS--T 470
            |.:. .::|..|   ::..|..|:......|..:.||.                .:|.||.:  |
Human   229 ETAPITTDLAHI---QKAATVYKTKGFAQRDFSEAPKF----------------TQPLADCTTVT 274

  Fly   471 GMSPKQSPSAKRKPKPQLIDNEQLTHEMSYGTSDHALKMDVRKSP 515
            |.:.:.....:..|:|::|..:.              |||::.:|
Human   275 GYNTQLFCCVRASPRPKIIWLKN--------------KMDIQGNP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020
I-set 138..227 CDD:254352 86/305 (28%)
Ig 155..224 CDD:143165
IG_like 243..323 CDD:214653 22/81 (27%)
Ig 250..323 CDD:299845 21/74 (28%)
FN3 327..411 CDD:238020 37/94 (39%)
MYBPHLNP_001010985.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47 86/305 (28%)
IG_like 61..142 CDD:214653 22/83 (27%)
Ig 70..142 CDD:299845 21/74 (28%)
FN3 146..235 CDD:238020 37/98 (38%)
I-set 261..350 CDD:254352 14/75 (19%)
Ig 280..344 CDD:143165 7/40 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000709
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.