DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MnM and Myom3

DIOPT Version :10

Sequence 1:NP_647779.2 Gene:MnM / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:NP_001101457.2 Gene:Myom3 / 313625 RGDID:1310060 Length:1438 Species:Rattus norvegicus


Alignment Length:640 Identity:135/640 - (21%)
Similarity:191/640 - (29%) Gaps:260/640 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SAERPSPPGRPILTPVALPEQQPDVVNLRWDRPLHDGGSPITGYTVEHRRMGSPHWVRATPTPVD 89
            :||:|..||.|:  .|.......|.:.|.|..|....||.||||::|..:..|..||....||..
  Rat   367 AAEKPGAPGSPL--NVRCLNVHRDCLTLTWVPPSDTRGSTITGYSIELCQGDSEEWVPCLKTPGG 429

  Fly    90 RCDVCISGLEPGWRYQFRCFAENIVGRS------------------------------------- 117
            .|...|.||..|..|:||..|.:..|.|                                     
  Rat   430 TCRCPIQGLIEGQSYRFRVRAISKAGTSLPSKASAAVVMGDYDTVQKKTEIPFDLGRKITISKND 494

  Fly   118 --------------DASELSD----------------PLTVTLQRNA--------------ITVP 138
                          .|||:.|                |||.||:::.              |..|
  Rat   495 FEDAVTIPSAPTNVHASEIRDTYAVLSWEEPHPRGRAPLTYTLEKSVIGSGTWEAISSETPIKSP 559

  Fly   139 RFIDELVDTNAVEDERIEFRVRILGE-----------------------PPPEINWFKD------ 174
            ||  .|:|..  :.:...||||.|.:                       ||.::..|::      
  Rat   560 RF--ALLDLE--KGKSYVFRVRALNQYGMSDPSEPSEPITLKGKPATLPPPAQVQSFRNTQTSVS 620

  Fly   175 -------------GYEIFSSR---------RTKIVNDNEASV----------LVIHQVALTDEGE 207
                         ||.|:|..         ..|.:.|.:.:|          ..|..|:....||
  Rat   621 LTWEPVDGGSELLGYYIYSREAGASEWQTVNNKPIQDTKFTVPGLRTGKEYEFCIRSVSEAGVGE 685

  Fly   208 I----------KCTATNRAGHVIT-----KARLMV-QAPPKIRLPRTYEDGLIVEADEVLRLKVG 256
            .          :..||..|.:...     |..::: ..|||.|           ...::|...|.
  Rat   686 SSAVTQPIRVKQALATPSAPYDFALLNCGKNEMVIGWKPPKRR-----------GGGKILGYYVD 739

  Fly   257 -----------VAGQPPPA----ITWLHE----------------GEVIAPGGRFEVSNTEKNSL 290
                       |:.||.|:    :|.|||                ||:.||...||         
  Rat   740 QHDSEELDWHPVSHQPNPSRVCKVTNLHEGHFYEFRARAMNWAGIGELSAPSSLFE--------- 795

  Fly   291 LKIDNVLREDRGEYMVKAWNRLGEDSTSFLVTVTARPNPPGTPKLNMSFGKSATLSWTAPLDDGG 355
                           .|.|             ....|.||...:.:.....|..|.|..||..|.
  Rat   796 ---------------CKEW-------------TMPEPGPPYDVRASEIQATSVMLQWEPPLYIGA 832

  Fly   356 CKIGNYIVEYFRVGWNVWLKAATTRALSTT---LHDLIEGSEYKFRVKAENPYGLSEPSGESELL 417
            ..:..|.|.:..:|...| |..|..|.|.|   :.||..|.:|.|||:|.|..||.:||..::.:
  Rat   833 GPVTGYRVSFQEIGSEEW-KPVTPDATSDTHLRVSDLQPGKQYMFRVQAMNSAGLGQPSVPTDPV 896

  Fly   418 FIPDPKRGITKPKS-ATRIAGDEKDKPKTGAGGMQVPP------RRKTLSPPRPQ 465
            .:.|      ||.: ...:..||:.:........:.|.      .:....||.||
  Rat   897 LLED------KPDAHEIEVGVDEEGQIYLAFEAPEAPDFPEFQWSKDYKGPPDPQ 945

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MnMNP_647779.2 FN3 29..127 CDD:238020 37/164 (23%)
I-set 138..227 CDD:400151 28/164 (17%)
Ig strand B 155..159 CDD:409565 1/3 (33%)
Ig strand C 168..172 CDD:409565 0/3 (0%)
Ig strand E 194..197 CDD:409565 1/12 (8%)
Ig strand F 207..212 CDD:409565 1/14 (7%)
Ig strand G 220..223 CDD:409565 0/7 (0%)
Ig 243..323 CDD:472250 18/110 (16%)
Ig strand B 251..255 CDD:409353 1/3 (33%)
Ig strand C 264..268 CDD:409353 1/7 (14%)
Ig strand E 289..293 CDD:409353 0/3 (0%)
Ig strand F 303..308 CDD:409353 0/4 (0%)
Ig strand G 316..319 CDD:409353 0/2 (0%)
FN3 327..411 CDD:238020 29/86 (34%)
PHA03247 <420..718 CDD:223021 10/53 (19%)
Myom3NP_001101457.2 Ig 154..248 CDD:472250
Ig strand B 171..175 CDD:409353
Ig strand C 184..188 CDD:409353
Ig strand E 213..217 CDD:409353
Ig strand F 227..232 CDD:409353
Ig strand G 240..243 CDD:409353
Ig 272..363 CDD:472250
Ig strand C 304..308 CDD:409353
Ig strand E 329..333 CDD:409353
Ig strand F 343..348 CDD:409353
Ig strand G 356..359 CDD:409353
FN3 374..460 CDD:238020 31/87 (36%)
FN3 <437..>709 CDD:442628 46/275 (17%)
FN3 702..792 CDD:238020 20/100 (20%)
FN3 804..893 CDD:238020 31/89 (35%)
IG_like 1127..1207 CDD:214653
Ig strand B 1138..1142 CDD:409353
Ig strand C 1152..1156 CDD:409353
Ig strand E 1174..1178 CDD:409353
Ig strand F 1188..1193 CDD:409353
Ig strand G 1201..1204 CDD:409353
Ig 1336..1426 CDD:472250
Ig strand B 1354..1358 CDD:409353
Ig strand C 1367..1371 CDD:409353
Ig strand E 1392..1396 CDD:409353
Ig strand F 1406..1411 CDD:409353
Ig strand G 1419..1422 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.