DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and Mybphl

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:NP_001014064.1 Gene:Mybphl / 310782 RGDID:1310511 Length:355 Species:Rattus norvegicus


Alignment Length:352 Identity:89/352 - (25%)
Similarity:138/352 - (39%) Gaps:53/352 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 TATNRAGHVITKARLMVQAPPKIRLPRTYEDGLIVEADEVLRLKVGVAGQPPPAITWLHEGEVIA 275
            |....||....:....::..|||.|||......|.:..|.:.|.:...|:|.|...|.|.|..: 
  Rat    32 TRQQEAGSPSLQ
LLPSIEEHPKIWLPRALRQTYIRKVGETVNLLIPFQGKPKPQTIWTHNGSAL- 95

  Fly   276 PGGRFEVSNTEKNSLLKIDNVLREDRGEYMVKAWNRLG--EDSTSFLVTVTARPNPPGTPKLNMS 338
            ...|..|.|.|.:|:|.|....|.|.|.|.:..  :||  :.:.:..:.|..:|.||.:.||...
  Rat    96 DNSRVSVRNGEHDSILFIREAQRTDSGCYQLCV--QLGGLQATATINILV
IEKPGPPQSIKLVDV 158

  Fly   339 FGKSATLSWTAPLDDGGCKIGNYIVEYFRVGWNVWLKAATT-RALSTTLHDLIEGSEYKFRVKAE 402
            :|.:|||.||.|.|.|...:..|.|:.......:|...... ...|..:.|||.|:.|.|||.||
  Rat   159 WGANATLEWTPPQDTGNTALLGYTVQKADKKSGLWFTVLERYHRTSCIVSDLIVGNSYAFRVFAE 223

  Fly   403 NPYGLSEPSG-ESELLFIPDPKRGITKPKSATRIAGDEKDKPKTGAGGMQVPPRRKTLSPPRPQA 466
            |..|||:.:. .::|..|   ::..|..|:......|..:.||.                .:|.|
  Rat   224 NQCGLSDTAPVTADLAHI---QKAATVYKAKGFAQRDLSEAPKF----------------TQPLA 269

  Fly   467 DAS--TGMSPKQSPSAKRKPKPQLIDNEQLTHEMSYGTSDHALKMDVRKSPSLNSADSANKPTTD 529
            |.:  ||...:.....:..|||::|..:.              |||::.:|...:.......:.:
  Rat   270 DCTTVTGYDTQLFCCVRASPKPKIIWLKN--------------KMDLQGNPKYRALSQLGICSLE 320

  Fly   530 SSNPKLNLTLVTTTLAPLDKSVPSPKA 556
            ...|           :|.|..:.:.||
  Rat   321 IRKP-----------SPFDGGIYTCKA 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020
I-set 138..227 CDD:254352 3/15 (20%)
Ig 155..224 CDD:143165 3/12 (25%)
IG_like 243..323 CDD:214653 22/81 (27%)
Ig 250..323 CDD:299845 20/74 (27%)
FN3 327..411 CDD:238020 32/84 (38%)
MybphlNP_001014064.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 3/10 (30%)
IG_like 62..143 CDD:214653 22/83 (27%)
Ig 71..143 CDD:299845 20/74 (27%)
FN3 147..235 CDD:238020 32/87 (37%)
I-set 262..351 CDD:254352 20/116 (17%)
Ig 281..345 CDD:143165 13/81 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000709
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.