DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and Mybpc3

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:XP_006234565.1 Gene:Mybpc3 / 295929 RGDID:1305950 Length:1276 Species:Rattus norvegicus


Alignment Length:528 Identity:123/528 - (23%)
Similarity:196/528 - (37%) Gaps:127/528 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GRPKKNVHWKSAERPSPPGRPILTPVALPEQQPDVVNLRWDRPLHDGGSPITGYTVEHRRMGSPH 79
            |..:.|:..|..:.|..|..|.::.|.     .|...::|:.|.:|||.|:.||.:|.::..|..
  Rat   760 GEDQVNLTVKVIDVPDAPAAPKISNVG-----EDSCIVQWEPPAYDGGQPVLGYILERKKKKSYR 819

  Fly    80 WVRATPTPVDRCDVCISGLEPGWRYQFRCFAENIVGRSDASELSDP------------LTVTLQR 132
            |:|.....:.........:..|..|:.|.:|.|.||.|..|..|.|            |||    
  Rat   820 WMRLNFDLLRELSHEARRMIEGVAYEMRVYAVNAVGMSRPSPASQPFMPIGPPGEPTHLTV---- 880

  Fly   133 NAITVPRFIDELVDTNAVEDERIEFRVRILGEPPPEIN-WFKDGYEI----------------FS 180
                     :::.||.          |.:...||..:. ...|||.:                .:
  Rat   881 ---------EDVSDTT----------VSLKWRPPERVGAGGLDGYSVEYCQEGCSEWVTALQGLT 926

  Fly   181 SRRTKIVNDNEASVLVI-----HQVALTDEGEIKCTATNRAGHVITKARLMVQ---APPKIRLPR 237
            .|.:.:|.|......::     |.||            ...|.:|||..:.||   ..|:::|||
  Rat   927 ERTSLLVKDLPTGARLLFRVRAHNVA------------GPGGPIITKEPVTVQEILQRPRLQLPR 979

  Fly   238 TYEDGLIVEADEVLRLKVGVAGQPPPAITWLHEGEVIAPGGRFEVSNTEKNSLLKIDNVLREDRG 302
            .....:..:..|.:.|.:...|:|.|.:||..||:.:| |....:.|:..:::|.|....|...|
  Rat   980 HLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLA-GEEVSIRNSPTDTILFIRAAHRTHSG 1043

  Fly   303 EYMVKAWNRLGEDSTSFLVTVTARPNPPGTPKLNMSFGKSATLSWTAPLDDGGCKIGNYIV---- 363
            .|.|.......||..:.::.:..:|:||...::..::|.|..|.|..|.|||..:|..|.|    
  Rat  1044 TYQVTVRIENMEDKATLVLQIVDKPSPPLDIRVVETWGFSVALEWKPPQDDGNTEIWGYTVQKAD 1108

  Fly   364 ----EYFRVGWNVWLKAATTRALSTTLHDLIEGSEYKFRVKAENPYGLSE-PSGESELLFIPDPK 423
                |:|.|       ....|.....:.:||.|:.|.|||.:.|..|.|: .:...|.:|||.| 
  Rat  1109 KKTMEWFTV-------LEHYRQTHCVVSELIIGNGYYFRVFSHNMVGSSDRAAATKEPIFIPRP- 1165

  Fly   424 RGITKPKSATRIAGDEKDKPKTGAGGMQVPPRRKTL--------SPPRPQADASTGMSPKQSPSA 480
             |||                       ..||:.|.|        :.|........|.:.....:.
  Rat  1166 -GIT-----------------------YEPPKYKALDFSEAPSFTQPLTNRSIIAGYNAILCCAV 1206

  Fly   481 KRKPKPQL 488
            :..|||::
  Rat  1207 RGSPKPKI 1214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020 28/109 (26%)
I-set 138..227 CDD:254352 18/110 (16%)
Ig 155..224 CDD:143165 16/90 (18%)
IG_like 243..323 CDD:214653 20/79 (25%)
Ig 250..323 CDD:299845 19/72 (26%)
FN3 327..411 CDD:238020 28/92 (30%)
Mybpc3XP_006234565.1 I-set 12..94 CDD:254352
Ig <40..92 CDD:299845
I-set 161..260 CDD:254352
ig 165..249 CDD:278476
I-set 367..451 CDD:254352
IGc2 386..444 CDD:197706
I-set 458..543 CDD:254352
IGc2 470..528 CDD:197706
Ig 565..631 CDD:299845
Ig_C5_MyBP-C 658..770 CDD:143302 2/9 (22%)
I-set 658..770 CDD:254352 2/9 (22%)
FN3 774..864 CDD:238020 26/94 (28%)
FN3 872..965 CDD:238020 21/127 (17%)
IG_like 983..1064 CDD:214653 20/81 (25%)
Ig_Titin_like 992..1064 CDD:143225 19/72 (26%)
FN3 1068..1151 CDD:238020 27/89 (30%)
I-set 1183..1272 CDD:254352 5/32 (16%)
IGc2 1197..1259 CDD:197706 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000709
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X825
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.