DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and Mylk

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:NP_001099344.2 Gene:Mylk / 288057 RGDID:1310915 Length:1961 Species:Rattus norvegicus


Alignment Length:511 Identity:124/511 - (24%)
Similarity:197/511 - (38%) Gaps:93/511 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GGRPKKNVHWKSAERPSPPG--RPI--LTPV--ALP-EQQPDVVNLRWDRPLHDGGSPITGYTVE 71
            ||...:.::.|:.|.|:|.|  :|:  |.|:  |.| |....|.|.:....|...|:.....|::
  Rat   992 GGNTAEVLNVKAGESPTPAGNAQPVGALKPIGNAKPAETLKSVGNAKPAETLKPVGNAKPAETLK 1056

  Fly    72 ----------------HRRMGSPHWV-RATPTPVDRCDVCISGLEPGWRYQFRCFAENIVGRSDA 119
                            .:..|||..: .|.|....:........|          ...:.|:.:.
  Rat  1057 PVGNVKPAETLKPIANAQPSGSPKPIANAQPIETQKSVANAKSAE----------TPKLAGKEEL 1111

  Fly   120 SELSDPLTVTLQRNAIT-----------VPRFIDELVDTNAVEDERIEFRVRILGEPPPEINWFK 173
            .|:.:.:.........|           .|.|.::|.|.:..|.|::..:.::..:||..:.|..
  Rat  1112 KEVRNDVNCKKAHVGATGNEKRPESQGSAPVFKEKLQDVHVAEGEKLLLQCQVTSDPPATVTWTL 1176

  Fly   174 DGYEIFSSRRTKIVNDNEASVLVIHQVALTDEGEIKCTATNRAGHVITKARLMV---------QA 229
            :|..:.:::...:..:.....:.|.:....|.|..||.|.|.||......::.|         :|
  Rat  1177 NGKTLKTTKFIILAQEGSLFSVSIEKALPEDRGLYKCVAKNSAGQAECSCQVTVDDAGTSENTKA 1241

  Fly   230 PP-KIRLPR--------TYEDGLI--------------------------VEADEVLRLKVGVAG 259
            |. |.|.|:        |..|..:                          |.|.|.:.|...|.|
  Rat  1242 PEMKSRRPKSSLTPVLGTESDATVKKKPASKTPTKAAMPPQIIQFPEDQKVRAGEPVELFGKVTG 1306

  Fly   260 QPPPAITWLHEGEVIAPGGRFEVSNTEKNSLLKIDNVLREDRGEYMVKAWNRLGEDSTSFLVTVT 324
            ..|...||:...:.|.......|.|:|..|.|.|....:|..|.|.:...|:|........:||.
  Rat  1307 TQPITCTWMKFRKQIQESENIRVENSESGSKLTILAARQEHCGCYTLVVENKLSSRQAQVNLTVV 1371

  Fly   325 ARPNPP-GTPKLNMSFGKSATLSWTAPLDDGGCKIGNYIVEYFRVGWNVWLKAATTRALSTTLHD 388
            .:|:|| |||..:.....|.||||.....|||..:.:|.||.:.....||.:.||.|:.|..:.|
  Rat  1372 DKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYNVEIWDTEDKVWTELATCRSTSFNVQD 1436

  Fly   389 LIEGSEYKFRVKAENPYGLSEPSGESELLFIPDPKRGITKPKSATRIAGDEKDKPK 444
            |:...||||||:|.|.||.||||.||||..:.:...   :||....::.|::.:|:
  Rat  1437 LLPDREYKFRVRAVNVYGTSEPSQESELTAVGEKPE---EPKDEVEVSDDDEKEPE 1489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020 22/121 (18%)
I-set 138..227 CDD:254352 19/88 (22%)
Ig 155..224 CDD:143165 13/68 (19%)
IG_like 243..323 CDD:214653 21/105 (20%)
Ig 250..323 CDD:299845 18/72 (25%)
FN3 327..411 CDD:238020 37/84 (44%)
MylkNP_001099344.2 I-set 42..132 CDD:254352
Ig 64..129 CDD:143165
I-set 165..254 CDD:254352
Ig 183..251 CDD:143165
23ISL 255..408 CDD:293226
I-set 410..500 CDD:254352
Ig 427..497 CDD:143165
I-set 510..596 CDD:254352
IGc2 523..586 CDD:197706
I-set 619..708 CDD:254352
Ig 636..704 CDD:143165
I-set 717..805 CDD:254352
Ig 720..805 CDD:299845
I-set 1141..1230 CDD:254352 19/88 (22%)
IGc2 1154..1220 CDD:197706 13/65 (20%)
Ig 1281..1378 CDD:299845 25/96 (26%)
I-set 1281..1370 CDD:254352 21/88 (24%)
FN3 1374..1465 CDD:238020 42/90 (47%)
STKc_MLCK1 1504..1762 CDD:271093
Pkinase 1507..1762 CDD:278497
I-set 1852..1942 CDD:254352
IGc2 1865..1932 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0613
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.