DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and IGSF22

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:XP_011518332.1 Gene:IGSF22 / 283284 HGNCID:26750 Length:1346 Species:Homo sapiens


Alignment Length:467 Identity:123/467 - (26%)
Similarity:182/467 - (38%) Gaps:58/467 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PPG---RPILTPVALPEQQPDVVNLRWDRPLHDGGSPITGYTVEHRRMGSPHWVRATPTPVDRCD 92
            |||   :|.:|.|.     .:.|.:.|:.|..|||:|:.||.||.|:.||..||.....|:....
Human   821 PPGFASQPQVTDVT-----KEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTK 880

  Fly    93 VCISGLEPGWRYQFRCFAENIVGRSDASELSDPLTVTLQRNAITVPRFIDEL-VDTNAVEDERIE 156
            ..:.||.....|:||..|.|..|   ..:.|.|.:..:.::.:..|..:.:| |..::.....:.
Human   881 CTVDGLLEDTEYEFRVIAVNKAG---PGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLA 942

  Fly   157 FRVRILGEPPPEINWFKDGYEIFSSRRTKIVNDNEASVLVIHQVALTDEGEI-------KCTATN 214
            :|....|:||       .|| |...|.......::.:.:.|.....|..|.|       :..|.|
Human   943 WREPAEGDPP-------SGY-ILEMRAEDTKEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVN 999

  Fly   215 RAG-----HVITKARLM-VQAPPKIRLPRTYEDGLIVEADEVLRLKVGVAGQPPPAITWLHEGEV 273
            .||     .:....|.| ..|.||..|....:..::|.|...|.:....:|.|||.:.|..:|  
Human  1000 EAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDG-- 1062

  Fly   274 IAPGGRFEVSNTEKNSLLKIDNVLREDRGEYMVKAWNRLGEDSTSFLVTVTARPNPPGTPKLNMS 338
            :...||..::.::.:|...|::..|.|.|.|.:...|..||......|.|...|.||...:|...
Human  1063 VPTKGRETITKSKNHSQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEE 1127

  Fly   339 FGKSATLSWTAPLD---DGGCKIGNYIVEYFRVGWNVWLKAATTRALST--TLHDLIEGSEYKFR 398
            ...:.||:|....|   ||.   .:||:.........|..|| .|..|.  |:..|:.|.:|.||
Human  1128 VPNTVTLTWNHSPDVQEDGE---AHYIIMKRDASTATWYTAA-ERVFSNKYTVTGLLPGRKYYFR 1188

  Fly   399 VKAENPYGLSEPSGESELLFIPDPKRGITKPKSATRIAGDEKD-----------KPKTGAGGMQV 452
            |.|.|..|.|||....:...|   .:...:..||.....::||           ||.|...|...
Human  1189 VVARNEIGDSEPLDSRDTWLI---NKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDC 1250

  Fly   453 PPRRKTLSPPRP 464
            ......|..|||
Human  1251 TMTCAFLGNPRP 1262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020 33/98 (34%)
I-set 138..227 CDD:254352 21/102 (21%)
Ig 155..224 CDD:143165 16/80 (20%)
IG_like 243..323 CDD:214653 21/79 (27%)
Ig 250..323 CDD:299845 19/72 (26%)
FN3 327..411 CDD:238020 29/88 (33%)
IGSF22XP_011518332.1 I-set 87..177 CDD:254352
Ig 104..>164 CDD:299845
I-set 255..343 CDD:254352
Ig 264..338 CDD:299845
I-set 349..434 CDD:254352
Ig 372..434 CDD:143165
IG_like 446..529 CDD:214653
Ig 456..512 CDD:143165
IG_like 541..618 CDD:214653
IG_like 637..717 CDD:214653
Ig_Titin_like 647..717 CDD:143225
FN3 721..813 CDD:238020
FN3 822..912 CDD:238020 32/97 (33%)
FN3 923..1008 CDD:238020 19/92 (21%)
IG_like 1032..1112 CDD:214653 21/81 (26%)
Ig_Titin_like 1042..1112 CDD:143225 19/71 (27%)
FN3 1116..1203 CDD:238020 30/90 (33%)
I-set 1233..1322 CDD:254352 8/30 (27%)
Ig 1256..1322 CDD:299845 4/7 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0613
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.