DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and Ttn

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:NP_001372637.1 Gene:Ttn / 22138 MGIID:98864 Length:35463 Species:Mus musculus


Alignment Length:1405 Identity:296/1405 - (21%)
Similarity:472/1405 - (33%) Gaps:391/1405 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KKNV--HWK-------------SAERPSPPGRPILTPVALPEQQPDV-------VNLRWDRPLHD 60
            |:||  |::             .:|.|..|..| |.|...|...|:|       |:|.|.||..|
Mouse 32280 KENVEYHFRVSAENQFGISKPLKSEEPVIPKTP-LNPPEPPSNPPEVLDVTKSSVSLSWSRPKDD 32343

  Fly    61 GGSPITGYTVEHRRMGSPHWVRATPTPVDRCDVCISGLEPGWRYQFRCFAENIVGRSDASELSDP 125
            |||.:|||.:|.:...:..|||...|.:......::||.|...||||..|:|.||.|:.|..|:|
Mouse 32344 GGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEP 32408

  Fly   126 L-----------------------TVTLQ------------------------------------ 131
            :                       :||||                                    
Mouse 32409 VVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIK 32473

  Fly   132 -------------------------------RNAITV---------PRFIDELVDTNAVEDERIE 156
                                           |.|::|         |....|:.|......|..:
Mouse 32474 DRQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSVKTKLTSGEAPGVRKEMADVTTKLGEAAQ 32538

  Fly   157 FRVRILGEPPPEINWFKDGYEIFSSRRTKIVNDNEASVLVIHQVALTDEGEIKCTATNRAGHVIT 221
            ...:|:|.|.|:|.|::.|.|:..||:.|:.:|.....|.:......|||...|.|||..|.|.:
Mouse 32539 LSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTDEQEDEGVYTCVATNEVGEVES 32603

  Fly   222 KARLMVQAPPKIRLPRTYEDGLIVEADEVLRLKVGVAGQPPPAITWLHEGEVIAPGGRFEVSNTE 286
            .::|::||.|:.......::.........|||.|...|:|.||:||.|..:::....:..:.|||
Mouse 32604 SSKLLLQAAPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSEKITIENTE 32668

  Fly   287 KNSLLKIDNVLREDR-GEYMVKAWNRLGEDSTSFLVTVTARPNPPGTP-KLNMSFGKSATLSWTA 349
            ..:.|.:.||.|:.. |:|.|:..|..|....:..|.:..:|:.|..| .:......|..:||..
Mouse 32669 HYTHLVMKNVQRKTHAGKYKVQLSNAFGTVDATLDVEIQDKPDKPTGPIVIEALLKNSVVISWKP 32733

  Fly   350 PLDDGGCKIGNYIVEYFR----VGWNVWLKAATTRALSTT---LHDLIEGSEYKFRVKAENPYGL 407
            |.||||..|.||:||...    ..|.:     .:.|:|.|   :.:|.|.:.|.|||.|:|.:|:
Mouse 32734 PADDGGSWITNYVVEKCEAKEGAEWQL-----VSSAISVTTCRIVNLTENAGYYFRVSAQNTFGI 32793

  Fly   408 SEPSGESELLFIPDP--KRGITKPKSATRIAGDE---KDKPKTGAGGMQVP----PRRKTLSPPR 463
            |||...:.::.|..|  |.|:....:.|.:..|.   ..||....||.::.    .||:      
Mouse 32794 SEPLEVASIVIIKSPFEKPGVPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLERRE------ 32852

  Fly   464 PQADASTGMSPKQSPSAKRKPKPQLIDNEQLTHEMSYGTSD--HALKMDVR-KSPSLNSA---DS 522
                             |::.|...:..|:: .|..:...:  ..|:.:.| |..:|...   ..
Mouse 32853 -----------------KKQNKWIAVTTEEI-RETVFSVQNLIEGLEYEFRVKCENLGGESEWSE 32899

  Fly   523 ANKPTTDSSNPKLNLTLVTTTLAPLDKSVPSPKAPRTPATSPLKLFNPKPSGAPKDRSPVQPKPQ 587
            .::|.|                                               ||...|:|    
Mouse 32900 ISEPVT-----------------------------------------------PKSDVPIQ---- 32913

  Fly   588 PLPTPPMETPDKASPNPKRSLSPPNKR---QPPPLRKSPTPPEPIKVTPALLRSAEPVQLGVNQN 649
                         :|:.|..|...|.|   ....:.|....|:||  .....:..|.:..|:...
Mouse 32914 -------------APHFKEELRNLNVRYQSNATLVCKVTGHPKPI--VKWYRQGKEIIADGLKYR 32963

  Fly   650 VRRFSGQTLSPARNVPTLALAVASGVSAVIGEKLPT-----------IEISAPPTPQEEEPPVLE 703
            ::.|.|       ....|.:|..:...|.:.:...|           :|:..|  .:...|..||
Mouse 32964 IQEFKG-------GYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVP--AKIHLPKTLE 33019

  Fly   704 R------------------SPSPEPAPKSQSNARRFSRSADKHDDVHTSNEFMLVVFDKNSKVKD 750
            .                  |..|:|....|........:.  |..|..:..|..:||....:.||
Mouse 33020 GMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNG--HYQVIVTRSFTSLVFSNGVERKD 33082

  Fly   751 --------KDK----QDSFELDLEDAIQPPPISISAPDLAFLEFTNLHTTFPLRRSVSS-TELLY 802
                    |::    |.:.|||:.| :..||..:...|:: .:..||..|.|.....|. |..:.
Mouse 33083 AGFYVVCAKNRFGIDQKTVELDVAD-VPDPPRGVKVSDVS-RDSVNLTWTEPASDGGSKVTNYIV 33145

  Fly   803 ERAMARFYEAVELEQASKSRKTSRDKLVTPVPHQTPANLRKRLGSISEAERLSFERRSEMRRQSA 867
            |:........:.:.||.::|             .|..||   .|..|...|:..|.:..:.:.|.
Mouse 33146 EKCATTAERWLRVGQARETR-------------YTVINL---FGKTSYQFRVIAENKFGLSKPSE 33194

  Fly   868 DVVSISRKWDSRENVN---EMGNLTRIHTTGQLPFETR---------KDLRESEAEEEHE----- 915
            .......|.|....:|   |:.....:.||.....:|:         :||...|....|.     
Mouse 33195 PSEPTVTKEDKTRAMNYDDEVDETREVTTTKASHSKTKELYEKYMIAEDLGRGEFGIVHRCVETS 33259

  Fly   916 ------------EGEEEHLTE---STADDSEDMDLDYDEDLDVDYPPQKKLQQQSSNDLGSDYTE 965
                        :|.::.|.:   |..:.:...::.|   |...:...::|........|.|..|
Mouse 33260 SKRTFMAKFVKVKGTDQVLVKKEISILNIARHRNILY---LHESFESMEELVMIFEFISGLDIFE 33321

  Fly   966 STASSEQDSIEKFKMELLARTRSPSPRDLETYHPRTMGAGTFTP----YRAPTPEQAAVVLNRPV 1026
            ...:|   :.|..:.|:::..|... ..||..|.:.:|.....|    |:........::     
Mouse 33322 RINTS---AFELNEREIVSYVRQVC-EALEFLHSQNIGHFDIRPENIIYQTRKNSTIKII----- 33377

  Fly  1027 PLPSPDFVPKPILKRSSNEHMEQAVSPLPSSFASEAPTIIVPPTATVANSNPSTLKMDLAKGIKS 1091
                 :|.....||...|..:   :...|..:|.|.....|..|||...| ..||...|..||..
Mouse 33378 -----EFGQARQLKPGDNFRL---LFTAPEYYAPEVHQHDVVSTATDMWS-LGTLVYVLLSGINP 33433

  Fly  1092 FFSRDKRSATEK--------NTEANEEISNPLERTNAAAIAADLEVKRKAKEEEELRRKEEERLM 1148
            |.:...:...|.        :.||.:|||  ||       |.|. |.|...:|.:.|....|.|.
Mouse 33434 FLAETNQQMIENIMNAEYTFDEEAFKEIS--LE-------AMDF-VDRLLVKERKSRMTASEALQ 33488

  Fly  1149 QEEAHAAVDHYS-DLVKEVGSSHKYHTPLYLDRDELKRAA 1187
            .......:|..| .:::.:.....|||.:..|.:.:..||
Mouse 33489 HPWLKQRIDRVSTKVIRTLKHRRYYHTLIKKDLNMVVSAA 33528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020 40/127 (31%)
I-set 138..227 CDD:254352 27/88 (31%)
Ig 155..224 CDD:143165 22/68 (32%)
IG_like 243..323 CDD:214653 24/80 (30%)
Ig 250..323 CDD:299845 24/73 (33%)
FN3 327..411 CDD:238020 31/91 (34%)
TtnNP_001372637.1 IgI_1_Titin_Z1z2-like 6..98 CDD:409566
Ig strand B 23..27 CDD:409566
Ig strand C 36..40 CDD:409566
Ig strand E 63..67 CDD:409566
Ig strand F 77..82 CDD:409566
Ig strand G 90..93 CDD:409566
IgI_2_Titin_Z1z2-like 103..193 CDD:409564
Ig strand B 121..125 CDD:409564
Ig strand C 134..138 CDD:409564
Ig strand E 159..163 CDD:409564
Ig strand F 173..178 CDD:409564
Ig strand G 186..189 CDD:409564
PRK12323 <253..>346 CDD:237057
Titin_Z 465..504 CDD:401109
Titin_Z 511..548 CDD:401109
Titin_Z 555..594 CDD:401109
Titin_Z 601..640 CDD:401109
Titin_Z 647..685 CDD:401109
Ig strand A 945..948 CDD:409353
I-set 946..1035 CDD:400151
Ig strand A' 951..955 CDD:409353
Ig strand B 963..971 CDD:409353
Ig strand C 976..981 CDD:409353
Ig strand C' 984..986 CDD:409353
Ig strand D 992..997 CDD:409353
Ig strand E 1000..1005 CDD:409353
Ig strand F 1014..1022 CDD:409353
Ig strand G 1025..1035 CDD:409353
I-set 1084..1173 CDD:400151
Ig strand A 1084..1087 CDD:409353
Ig strand A' 1090..1095 CDD:409353
Ig strand B 1100..1107 CDD:409353
Ig strand C 1114..1120 CDD:409353
Ig strand C' 1121..1124 CDD:409353
Ig strand D 1130..1137 CDD:409353
Ig strand E 1140..1150 CDD:409353
Ig strand F 1154..1162 CDD:409353
Ig strand G 1164..1173 CDD:409353
Ig 1295..1383 CDD:416386
Ig strand A' 1299..1304 CDD:409353
Ig strand B 1309..1316 CDD:409353
Ig strand C 1323..1329 CDD:409353
Ig strand C' 1330..1333 CDD:409353
Ig strand D 1339..1345 CDD:409353
Ig strand E 1348..1358 CDD:409353
Ig strand F 1362..1370 CDD:409353
Ig strand G 1372..1383 CDD:409353
Ig 1463..1553 CDD:416386
Ig strand A 1463..1466 CDD:409353
Ig strand A' 1469..1474 CDD:409353
Ig strand B 1479..1486 CDD:409353
Ig strand C 1493..1499 CDD:409353
Ig strand C' 1500..1503 CDD:409353
Ig strand D 1509..1515 CDD:409353
Ig strand E 1518..1528 CDD:409353
Ig strand F 1532..1540 CDD:409353
Ig strand G 1542..1553 CDD:409353
Ig 1562..1653 CDD:416386
Ig strand A 1562..1564 CDD:409353
Ig strand A' 1566..1572 CDD:409353
Ig strand B 1579..1586 CDD:409353
Ig strand C 1592..1597 CDD:409353
Ig strand C' 1599..1602 CDD:409353
Ig strand D 1610..1613 CDD:409353
Ig strand E 1618..1625 CDD:409353
Ig strand F 1632..1640 CDD:409353
Ig strand G 1643..1654 CDD:409353
Ig <1728..1800 CDD:416386
Ig strand C 1741..1746 CDD:409353
Ig strand C' 1749..1751 CDD:409353
Ig strand D 1757..1762 CDD:409353
Ig strand E 1765..1770 CDD:409353
Ig strand F 1779..1787 CDD:409353
Ig strand G 1790..1800 CDD:409353
I-set 1847..1935 CDD:400151
Ig strand A 1847..1849 CDD:409353
Ig strand A' 1851..1857 CDD:409353
Ig strand B 1864..1871 CDD:409353
Ig strand C 1877..1882 CDD:409353
Ig strand C' 1884..1887 CDD:409353
Ig strand E 1900..1907 CDD:409353
Ig strand F 1914..1922 CDD:409353
Ig strand G 1925..1936 CDD:409353
IgI_titin_I1-like 2084..2175 CDD:409543
Ig strand B 2101..2105 CDD:409543
Ig strand C 2114..2118 CDD:409543
Ig strand E 2140..2144 CDD:409543
Ig strand F 2154..2159 CDD:409543
Ig strand G 2167..2170 CDD:409543
Ig 2182..2268 CDD:416386
Ig strand A 2184..2186 CDD:409353
Ig strand A' 2189..2193 CDD:409353
Ig strand B 2197..2203 CDD:409353
Ig strand C 2210..2215 CDD:409353
Ig strand C' 2218..2221 CDD:409353
Ig strand D 2226..2231 CDD:409353
Ig strand E 2234..2239 CDD:409353
Ig strand F 2248..2253 CDD:409353
Ig 2274..2358 CDD:416386
Ig strand A' 2279..2284 CDD:409353
Ig strand B 2289..2296 CDD:409353
Ig strand C 2299..2308 CDD:409353
Ig strand C' 2309..2312 CDD:409353
Ig strand D 2318..2324 CDD:409353
Ig strand E 2326..2336 CDD:409353
Ig 2363..2434 CDD:416386
Ig strand A' 2368..2373 CDD:409353
Ig strand B 2378..2385 CDD:409353
Ig strand C 2391..2397 CDD:409353
Ig strand C' 2398..2401 CDD:409353
Ig strand D 2407..2413 CDD:409353
Ig strand E 2415..2425 CDD:409353
Ig 2453..2536 CDD:416386
Ig strand A' 2460..2463 CDD:409353
Ig strand B 2467..2473 CDD:409353
Ig strand C 2481..2486 CDD:409353
Ig strand C' 2489..2492 CDD:409353
Ig strand D 2497..2502 CDD:409353
Ig strand E 2505..2510 CDD:409353
Ig strand F 2519..2525 CDD:409353
Ig strand G 2528..2536 CDD:409353
Ig 2540..2623 CDD:416386
Ig strand C 2568..2573 CDD:409353
Ig strand C' 2576..2579 CDD:409353
Ig strand D 2584..2589 CDD:409353
Ig strand E 2592..2597 CDD:409353
Ig strand F 2606..2612 CDD:409353
Ig strand G 2615..2623 CDD:409353
Ig 2628..2710 CDD:416386
Ig strand C 2655..2660 CDD:409353
Ig strand C' 2663..2666 CDD:409353
Ig strand D 2671..2676 CDD:409353
Ig strand E 2679..2684 CDD:409353
Ig strand F 2693..2699 CDD:409353
Ig strand G 2702..2710 CDD:409353
Ig 2714..2798 CDD:416386
Ig strand A' 2717..2723 CDD:409353
Ig strand B 2730..2737 CDD:409353
Ig strand C 2743..2748 CDD:409353
Ig strand C' 2750..2753 CDD:409353
Ig strand D 2758..2762 CDD:409353
Ig strand E 2767..2774 CDD:409353
Ig strand G 2788..2799 CDD:409353
Ig 2802..2885 CDD:416386
Ig strand A' 2807..2812 CDD:409353
Ig strand B 2817..2824 CDD:409353
Ig strand C 2831..2836 CDD:409353
Ig strand C' 2837..2840 CDD:409353
Ig strand D 2846..2851 CDD:409353
Ig strand E 2854..2864 CDD:409353
Ig strand G 2875..2885 CDD:409353
Ig 2889..2972 CDD:416386
Ig strand A' 2892..2898 CDD:409353
Ig strand B 2905..2912 CDD:409353
Ig strand C 2918..2922 CDD:409353
Ig strand C' 2924..2927 CDD:409353
Ig strand D 2932..2936 CDD:409353
Ig strand E 2941..2948 CDD:409353
Ig strand F 2955..2963 CDD:409353
Ig 2977..3059 CDD:416386
Ig strand A' 2979..2985 CDD:409353
Ig strand B 2992..3001 CDD:409353
Ig strand C 3004..3009 CDD:409353
Ig strand C' 3011..3014 CDD:409353
Ig strand D 3019..3023 CDD:409353
Ig strand E 3028..3035 CDD:409353
Ig strand G 3049..3060 CDD:409353
I-set 3065..3148 CDD:400151
Ig strand A' 3068..3074 CDD:409353
Ig strand B 3081..3088 CDD:409353
Ig strand C 3093..3098 CDD:409353
Ig strand C' 3100..3103 CDD:409353
Ig strand E 3117..3124 CDD:409353
Ig strand G 3138..3149 CDD:409353
Ig 3159..3239 CDD:416386
Ig strand A' 3161..3165 CDD:409353
Ig strand B 3169..3175 CDD:409353
Ig strand C 3182..3187 CDD:409353
Ig strand C' 3190..3193 CDD:409353
Ig strand D 3198..3203 CDD:409353
Ig strand E 3206..3213 CDD:409353
Ig strand F 3222..3228 CDD:409353
Ig strand G 3231..3239 CDD:409353
Ig 3245..3335 CDD:416386
Ig strand A 3245..3247 CDD:409353
Ig strand A' 3249..3255 CDD:409353
Ig strand B 3262..3269 CDD:409353
Ig strand C 3275..3280 CDD:409353
Ig strand C' 3282..3285 CDD:409353
Ig strand D 3290..3294 CDD:409353
Ig strand E 3299..3306 CDD:409353
Ig strand F 3313..3321 CDD:409353
Ig strand G 3324..3335 CDD:409353
Ig strand A 3350..3353 CDD:409353
I-set 3351..3437 CDD:400151
Ig strand A' 3356..3360 CDD:409353
Ig strand B 3368..3376 CDD:409353
Ig strand C 3380..3385 CDD:409353
Ig strand C' 3388..3390 CDD:409353
Ig strand D 3396..3401 CDD:409353
Ig strand E 3404..3409 CDD:409353
Ig strand F 3418..3426 CDD:409353
Ig strand G 3429..3437 CDD:409353
I-set 3471..3562 CDD:400151
Ig strand A 3471..3473 CDD:409353
Ig strand A' 3475..3481 CDD:409353
Ig strand B 3488..3495 CDD:409353
Ig strand C 3501..3506 CDD:409353
Ig strand C' 3508..3511 CDD:409353
Ig strand D 3518..3522 CDD:409353
Ig strand E 3527..3534 CDD:409353
Ig strand F 3541..3549 CDD:409353
Ig strand G 3552..3562 CDD:409353
I-set 3634..3721 CDD:400151
Ig strand A 3634..3637 CDD:409353
Ig strand A' 3640..3645 CDD:409353
Ig strand B 3650..3657 CDD:409353
Ig strand C 3664..3670 CDD:409353
Ig strand C' 3671..3674 CDD:409353
Ig strand D 3679..3685 CDD:409353
Ig strand E 3688..3698 CDD:409353
Ig strand F 3702..3710 CDD:409353
Ig strand G 3712..3723 CDD:409353
I-set 3750..3840 CDD:400151
Ig strand B 3765..3774 CDD:409353
Ig strand C 3779..3785 CDD:409353
Ig strand C' 3788..3790 CDD:409353
Ig strand D 3796..3801 CDD:409353
Ig strand E 3804..3812 CDD:409353
Ig strand F 3820..3827 CDD:409353
Ig strand G 3830..3840 CDD:409353
Ig 4376..4463 CDD:416386
Ig strand A 4376..4379 CDD:409353
Ig strand A' 4382..4387 CDD:409353
Ig strand B 4392..4399 CDD:409353
Ig strand C 4404..4410 CDD:409353
Ig strand C' 4411..4414 CDD:409353
Ig strand D 4420..4426 CDD:409353
Ig strand E 4429..4438 CDD:409353
Ig strand F 4442..4450 CDD:409353
Ig strand G 4452..4463 CDD:409353
I-set 4469..4558 CDD:400151
Ig strand A 4469..4471 CDD:409353
Ig strand A' 4473..4479 CDD:409353
Ig strand B 4486..4493 CDD:409353
Ig strand C 4499..4504 CDD:409353
Ig strand C' 4506..4509 CDD:409353
Ig strand D 4514..4518 CDD:409353
Ig strand E 4523..4530 CDD:409353
Ig strand F 4537..4545 CDD:409353
Ig strand G 4548..4558 CDD:409353
I-set 4564..4653 CDD:400151
Ig strand A 4564..4567 CDD:409353
Ig strand A' 4570..4575 CDD:409353
Ig strand B 4580..4587 CDD:409353
Ig strand C 4594..4600 CDD:409353
Ig strand C' 4601..4604 CDD:409353
Ig strand D 4609..4615 CDD:409353
Ig strand E 4618..4628 CDD:409353
Ig strand F 4632..4640 CDD:409353
Ig strand G 4642..4653 CDD:409353
Ig 4657..4730 CDD:416386
Ig strand B 4674..4678 CDD:409353
Ig strand C 4687..4691 CDD:409353
Ig strand E 4712..4716 CDD:409353
Ig strand F 4726..4730 CDD:409353
I-set 4750..4840 CDD:400151
Ig strand B 4768..4772 CDD:409353
Ig strand C 4781..4785 CDD:409353
Ig strand E 4806..4810 CDD:409353
Ig strand F 4820..4825 CDD:409353
I-set 4844..4930 CDD:400151
Ig strand B 4861..4865 CDD:409353
Ig strand C 4874..4878 CDD:409353
Ig strand E 4899..4903 CDD:409353
Ig strand F 4913..4918 CDD:409353
I-set 4937..5026 CDD:400151
Ig strand A 4937..4939 CDD:409353
Ig strand A' 4942..4947 CDD:409353
Ig strand B 4954..4962 CDD:409353
Ig strand C 4967..4971 CDD:409353
Ig strand C' 4975..4977 CDD:409353
Ig strand D 4982..4988 CDD:409353
Ig strand E 4991..4996 CDD:409353
Ig strand F 5005..5013 CDD:409353
Ig strand G 5016..5027 CDD:409353
I-set 5039..5119 CDD:400151
Ig strand B 5047..5051 CDD:409353
Ig strand C 5060..5064 CDD:409353
Ig strand E 5085..5089 CDD:409353
Ig strand F 5099..5104 CDD:409353
Ig strand G 5113..5116 CDD:409353
I-set 5126..5215 CDD:400151
Ig strand B 5144..5147 CDD:409353
Ig strand C 5156..5160 CDD:409353
Ig strand E 5181..5185 CDD:409353
Ig strand F 5195..5200 CDD:409353
Ig strand G 5209..5212 CDD:409353
Ig strand A 5218..5221 CDD:409353
I-set 5219..5308 CDD:400151
Ig strand A' 5224..5228 CDD:409353
Ig strand B 5236..5244 CDD:409353
Ig strand C 5249..5254 CDD:409353
Ig strand C' 5257..5259 CDD:409353
Ig strand D 5265..5270 CDD:409353
Ig strand E 5273..5278 CDD:409353
Ig strand F 5287..5295 CDD:409353
Ig strand G 5298..5308 CDD:409353
I-set 5314..5402 CDD:400151
Ig strand A' 5318..5323 CDD:409353
Ig strand B 5329..5336 CDD:409353
Ig strand C 5343..5349 CDD:409353
Ig strand C' 5350..5353 CDD:409353
Ig strand D 5359..5365 CDD:409353
Ig strand E 5368..5377 CDD:409353
Ig strand F 5381..5389 CDD:409353
I-set 5406..5494 CDD:400151
Ig strand B 5423..5427 CDD:409353
Ig strand C 5436..5440 CDD:409353
Ig strand E 5461..5465 CDD:409353
Ig strand F 5475..5480 CDD:409353
Ig 5499..5588 CDD:416386
Ig strand C 5529..5533 CDD:409353
Ig strand E 5554..5558 CDD:409353
Ig strand F 5568..5573 CDD:409353
Ig 5600..5681 CDD:416386
Ig strand A 5601..5604 CDD:409353
Ig strand B 5609..5615 CDD:409353
Ig strand C 5621..5627 CDD:409353
Ig strand D 5639..5644 CDD:409353
Ig strand E 5645..5651 CDD:409353
Ig strand F 5660..5668 CDD:409353
Ig strand G 5671..5681 CDD:409353
I-set 5688..5777 CDD:400151
Ig strand C 5718..5722 CDD:409353
Ig strand E 5743..5747 CDD:409353
Ig strand F 5757..5762 CDD:409353
Ig strand A 5780..5783 CDD:409353
Ig 5781..5870 CDD:416386
Ig strand A' 5786..5790 CDD:409353
Ig strand B 5798..5806 CDD:409353
Ig strand C 5811..5816 CDD:409353
Ig strand C' 5819..5821 CDD:409353
Ig strand D 5827..5832 CDD:409353
Ig strand E 5835..5840 CDD:409353
Ig strand F 5849..5857 CDD:409353
Ig strand G 5860..5870 CDD:409353
I-set 5874..5964 CDD:400151
Ig strand B 5893..5896 CDD:409353
Ig strand C 5905..5909 CDD:409353
Ig strand E 5930..5934 CDD:409353
Ig strand F 5944..5949 CDD:409353
Ig strand G 5957..5960 CDD:409353
I-set 5968..6056 CDD:400151
Ig strand A 5968..5970 CDD:409353
Ig strand A' 5972..5978 CDD:409353
Ig strand B 5985..5992 CDD:409353
Ig strand C 5998..6003 CDD:409353
Ig strand C' 6005..6008 CDD:409353
Ig strand D 6013..6017 CDD:409353
Ig strand E 6022..6029 CDD:409353
Ig strand F 6036..6044 CDD:409353
Ig strand G 6047..6058 CDD:409353
I-set 6061..6150 CDD:400151
Ig strand B 6078..6082 CDD:409353
Ig strand C 6091..6095 CDD:409353
Ig strand E 6116..6120 CDD:409353
Ig strand F 6130..6135 CDD:409353
I-set 6155..6243 CDD:400151
Ig strand B 6171..6175 CDD:409353
Ig strand C 6184..6188 CDD:409353
Ig strand E 6209..6213 CDD:409353
Ig strand F 6223..6228 CDD:409353
Ig strand A 6249..6252 CDD:409353
I-set 6250..6339 CDD:400151
Ig strand A' 6255..6259 CDD:409353
Ig strand B 6267..6275 CDD:409353
Ig strand C 6280..6285 CDD:409353
Ig strand C' 6288..6290 CDD:409353
Ig strand D 6296..6301 CDD:409353
Ig strand E 6304..6309 CDD:409353
Ig strand F 6318..6326 CDD:409353
Ig strand G 6329..6339 CDD:409353
Ig strand A 6342..6345 CDD:409353
I-set 6343..6432 CDD:400151
Ig strand A' 6348..6352 CDD:409353
Ig strand B 6360..6368 CDD:409353
Ig strand C 6373..6378 CDD:409353
Ig strand C' 6381..6383 CDD:409353
Ig strand D 6389..6394 CDD:409353
Ig strand E 6397..6402 CDD:409353
Ig strand F 6411..6419 CDD:409353
Ig strand G 6422..6432 CDD:409353
I-set 6436..6526 CDD:400151
Ig strand A 6436..6439 CDD:409353
Ig strand A' 6442..6447 CDD:409353
Ig strand B 6453..6460 CDD:409353
Ig strand C 6467..6473 CDD:409353
Ig strand C' 6474..6477 CDD:409353
Ig strand D 6483..6489 CDD:409353
Ig strand E 6491..6501 CDD:409353
Ig strand F 6505..6513 CDD:409353
Ig strand G 6515..6526 CDD:409353
I-set 6530..6618 CDD:400151
Ig strand B 6547..6551 CDD:409353
Ig strand C 6560..6564 CDD:409353
Ig strand E 6585..6589 CDD:409353
Ig strand F 6599..6604 CDD:409353
Ig strand A 6622..6626 CDD:409353
I-set 6623..6713 CDD:400151
Ig strand A' 6631..6635 CDD:409353
Ig strand B 6639..6648 CDD:409353
Ig strand C 6652..6658 CDD:409353
Ig strand C' 6661..6664 CDD:409353
Ig strand D 6670..6675 CDD:409353
Ig strand E 6679..6684 CDD:409353
Ig strand F 6692..6700 CDD:409353
Ig strand G 6703..6713 CDD:409353
I-set 6718..6806 CDD:400151
Ig strand C 6747..6751 CDD:409353
Ig strand E 6772..6776 CDD:409353
Ig strand F 6786..6791 CDD:409353
Ig strand G 6800..6803 CDD:409353
I-set 6813..6902 CDD:400151
Ig strand C 6843..6847 CDD:409353
Ig strand E 6868..6872 CDD:409353
Ig strand F 6882..6887 CDD:409353
Ig strand A 6905..6908 CDD:409353
I-set 6906..6995 CDD:400151
Ig strand A' 6914..6917 CDD:409353
Ig strand B 6922..6930 CDD:409353
Ig strand C 6936..6940 CDD:409353
Ig strand C' 6943..6946 CDD:409353
Ig strand D 6951..6957 CDD:409353
Ig strand E 6961..6966 CDD:409353
Ig strand F 6974..6982 CDD:409353
Ig strand G 6985..6995 CDD:409353
I-set 7001..7086 CDD:400151
Ig strand B 7016..7020 CDD:409353
Ig strand C 7029..7033 CDD:409353
Ig strand E 7054..7058 CDD:409353
Ig strand F 7068..7073 CDD:409353
I-set 7092..7173 CDD:400151
Ig strand B 7109..7113 CDD:409353
Ig strand C 7122..7126 CDD:409353
Ig strand E 7147..7151 CDD:409353
Ig strand F 7161..7166 CDD:409353
Ig strand G 7175..7178 CDD:409353
I-set 7188..7276 CDD:400151
Ig strand B 7205..7209 CDD:409353
Ig strand C 7218..7222 CDD:409353
Ig strand E 7243..7247 CDD:409353
Ig strand F 7257..7262 CDD:409353
I-set 7284..7373 CDD:400151
Ig strand A 7284..7287 CDD:409353
Ig strand A' 7290..7295 CDD:409353
Ig strand B 7300..7307 CDD:409353
Ig strand C 7314..7320 CDD:409353
Ig strand C' 7321..7324 CDD:409353
Ig strand D 7330..7336 CDD:409353
Ig strand E 7339..7348 CDD:409353
Ig strand F 7352..7360 CDD:409353
Ig strand G 7362..7373 CDD:409353
Ig strand A 7376..7379 CDD:409353
I-set 7377..7467 CDD:400151
Ig strand A' 7382..7386 CDD:409353
Ig strand B 7395..7403 CDD:409353
Ig strand C 7408..7413 CDD:409353
Ig strand C' 7416..7418 CDD:409353
Ig strand D 7424..7429 CDD:409353
Ig strand E 7432..7437 CDD:409353
Ig strand F 7446..7454 CDD:409353
Ig strand G 7457..7467 CDD:409353
Ig strand A 7470..7473 CDD:409353
I-set 7471..7559 CDD:400151
Ig strand A' 7476..7480 CDD:409353
Ig strand B 7488..7496 CDD:409353
Ig strand C 7501..7506 CDD:409353
Ig strand C' 7509..7511 CDD:409353
Ig strand D 7517..7522 CDD:409353
Ig strand E 7525..7530 CDD:409353
Ig strand F 7539..7547 CDD:409353
Ig strand A 7563..7567 CDD:409353
I-set 7564..7654 CDD:400151
Ig strand A' 7572..7576 CDD:409353
Ig strand B 7580..7589 CDD:409353
Ig strand C 7593..7599 CDD:409353
Ig strand C' 7602..7605 CDD:409353
Ig strand D 7611..7616 CDD:409353
Ig strand E 7620..7625 CDD:409353
Ig strand F 7633..7641 CDD:409353
Ig strand G 7644..7660 CDD:409353
Ig strand A 7657..7664 CDD:409353
I-set 7660..7747 CDD:400151
Ig strand A' 7665..7670 CDD:409353
Ig strand B 7675..7683 CDD:409353
Ig strand C 7687..7693 CDD:409353
Ig strand C' 7695..7697 CDD:409353
Ig strand D 7703..7709 CDD:409353
Ig strand E 7712..7718 CDD:409353
Ig strand F 7727..7734 CDD:409353
Ig strand A 7753..7756 CDD:409353
I-set 7754..7843 CDD:400151
Ig strand A' 7759..7763 CDD:409353
Ig strand B 7771..7779 CDD:409353
Ig strand C 7784..7789 CDD:409353
Ig strand C' 7792..7794 CDD:409353
Ig strand D 7800..7805 CDD:409353
Ig strand E 7808..7813 CDD:409353
Ig strand F 7822..7830 CDD:409353
Ig strand G 7833..7843 CDD:409353
Ig strand A 7846..7849 CDD:409353
I-set 7847..7936 CDD:400151
Ig strand A' 7852..7856 CDD:409353
Ig strand B 7864..7872 CDD:409353
Ig strand C 7877..7882 CDD:409353
Ig strand C' 7885..7887 CDD:409353
Ig strand D 7893..7898 CDD:409353
Ig strand E 7901..7906 CDD:409353
Ig strand F 7915..7923 CDD:409353
Ig strand G 7926..7936 CDD:409353
Ig 7942..8029 CDD:416386
Ig strand A' 7944..7950 CDD:409353
Ig strand B 7957..7964 CDD:409353
Ig strand C 7970..7975 CDD:409353
Ig strand C' 7977..7980 CDD:409353
Ig strand D 7985..7989 CDD:409353
Ig strand E 7994..8001 CDD:409353
Ig strand F 8008..8016 CDD:409353
Ig strand G 8019..8029 CDD:409353
I-set 8033..8122 CDD:400151
Ig strand B 8050..8054 CDD:409353
Ig strand C 8063..8067 CDD:409353
Ig strand E 8088..8092 CDD:409353
Ig strand F 8102..8107 CDD:409353
Ig strand G 8116..8119 CDD:409353
I-set 8129..8217 CDD:400151
Ig strand B 8146..8150 CDD:409353
Ig strand C 8159..8163 CDD:409353
Ig strand E 8184..8188 CDD:409353
Ig strand F 8198..8203 CDD:409353
I-set 8225..8314 CDD:400151
Ig strand A 8225..8228 CDD:409353
Ig strand A' 8231..8236 CDD:409353
Ig strand B 8241..8248 CDD:409353
Ig strand C 8255..8261 CDD:409353
Ig strand C' 8262..8265 CDD:409353
Ig strand D 8271..8277 CDD:409353
Ig strand E 8279..8289 CDD:409353
Ig strand F 8293..8301 CDD:409353
Ig strand G 8303..8314 CDD:409353
Ig 8318..8395 CDD:416386
Ig strand C 8349..8353 CDD:409353
Ig strand E 8374..8378 CDD:409353
Ig strand F 8388..8393 CDD:409353
Ig strand A 8411..8414 CDD:409353
I-set 8412..8500 CDD:400151
Ig strand A' 8417..8421 CDD:409353
Ig strand B 8429..8437 CDD:409353
Ig strand C 8442..8447 CDD:409353
Ig strand C' 8450..8452 CDD:409353
Ig strand D 8458..8463 CDD:409353
Ig strand E 8466..8471 CDD:409353
Ig strand F 8480..8488 CDD:409353
Ig strand A 8504..8507 CDD:409353
I-set 8505..8595 CDD:400151
Ig strand A' 8510..8514 CDD:409353
Ig strand B 8522..8530 CDD:409353
Ig strand C 8535..8540 CDD:409353
Ig strand C' 8543..8545 CDD:409353
Ig strand D 8552..8557 CDD:409353
Ig strand E 8560..8565 CDD:409353
Ig strand F 8574..8582 CDD:409353
Ig strand G 8585..8595 CDD:409353
I-set 8601..8688 CDD:400151
Ig strand B 8617..8620 CDD:409353
Ig strand C 8629..8633 CDD:409353
Ig strand E 8654..8658 CDD:409353
Ig strand F 8668..8673 CDD:409353
Ig strand A 8694..8697 CDD:409353
I-set 8695..8784 CDD:400151
Ig strand A' 8700..8704 CDD:409353
Ig strand B 8712..8720 CDD:409353
Ig strand C 8725..8730 CDD:409353
Ig strand C' 8733..8735 CDD:409353
Ig strand D 8741..8746 CDD:409353
Ig strand E 8749..8754 CDD:409353
Ig strand F 8763..8771 CDD:409353
Ig strand G 8774..8784 CDD:409353
I-set 8788..8877 CDD:400151
Ig strand B 8805..8809 CDD:409353
Ig strand C 8818..8822 CDD:409353
Ig strand E 8843..8847 CDD:409353
Ig strand F 8857..8862 CDD:409353
I-set 8883..8967 CDD:400151
Ig strand A 8890..8893 CDD:409353
Ig strand B 8898..8904 CDD:409353
Ig strand C 8910..8916 CDD:409353
Ig strand D 8928..8933 CDD:409353
Ig strand E 8934..8940 CDD:409353
Ig strand F 8949..8957 CDD:409353
I-set 8974..9063 CDD:400151
Ig strand B 8991..8995 CDD:409353
Ig strand C 9004..9008 CDD:409353
Ig strand E 9029..9033 CDD:409353
Ig strand F 9043..9048 CDD:409353
Ig strand G 9057..9060 CDD:409353
Ig strand A 9069..9072 CDD:409353
I-set 9070..9158 CDD:400151
Ig strand A' 9075..9079 CDD:409353
Ig strand B 9087..9095 CDD:409353
Ig strand C 9100..9105 CDD:409353
Ig strand C' 9108..9110 CDD:409353
Ig strand D 9116..9121 CDD:409353
Ig strand E 9124..9129 CDD:409353
Ig strand F 9138..9146 CDD:409353
Ig strand G 9149..9159 CDD:409353
I-set 9166..9255 CDD:400151
Ig strand B 9183..9187 CDD:409353
Ig strand C 9196..9200 CDD:409353
Ig strand E 9221..9225 CDD:409353
Ig strand F 9235..9240 CDD:409353
Ig strand G 9248..9251 CDD:409353
Ig 9262..9352 CDD:416386
Ig strand A 9262..9264 CDD:409353
Ig strand A' 9266..9271 CDD:409353
Ig strand B 9280..9287 CDD:409353
Ig strand C 9293..9298 CDD:409353
Ig strand C' 9300..9303 CDD:409353
Ig strand D 9308..9312 CDD:409353
Ig strand E 9317..9324 CDD:409353
Ig strand F 9331..9339 CDD:409353
Ig strand G 9342..9353 CDD:409353
Ig strand A 9358..9361 CDD:409353
I-set 9359..9448 CDD:400151
Ig strand A' 9364..9368 CDD:409353
Ig strand B 9376..9384 CDD:409353
Ig strand C 9389..9394 CDD:409353
Ig strand C' 9397..9399 CDD:409353
Ig strand D 9405..9410 CDD:409353
Ig strand E 9413..9418 CDD:409353
Ig strand F 9427..9435 CDD:409353
Ig strand G 9438..9448 CDD:409353
I-set 9469..9557 CDD:400151
Ig strand A' 9471..9477 CDD:409353
Ig strand B 9484..9491 CDD:409353
Ig strand C 9497..9502 CDD:409353
Ig strand D 9513..9517 CDD:409353
Ig strand E 9522..9529 CDD:409353
Ig strand F 9536..9544 CDD:409353
Ig strand G 9547..9557 CDD:409353
THB 9591..9621 CDD:408162
Ig 9675..9755 CDD:416386
Ig strand C 9700..9704 CDD:409353
Ig strand E 9725..9729 CDD:409353
Ig 9758..9840 CDD:416386
Ig strand A 9758..9761 CDD:409353
Ig strand A' 9764..9769 CDD:409353
Ig strand B 9774..9781 CDD:409353
Ig strand C 9787..9793 CDD:409353
Ig strand C' 9794..9797 CDD:409353
Ig strand D 9803..9808 CDD:409353
Ig strand E 9811..9821 CDD:409353
Ig strand G 9831..9842 CDD:409353
I-set 9848..9934 CDD:400151
Ig strand A' 9851..9857 CDD:409353
Ig strand B 9864..9871 CDD:409353
Ig strand C 9876..9881 CDD:409353
Ig strand C' 9883..9886 CDD:409353
Ig strand D 9891..9895 CDD:409353
Ig strand E 9900..9907 CDD:409353
Ig strand F 9914..9923 CDD:409353
PTZ00121 <10208..10736 CDD:173412
PPAK 11006..11030 CDD:397106
PPAK 11062..11086 CDD:397106
PPAK 11088..11114 CDD:397106
PPAK 11264..11288 CDD:397106
PTZ00449 <11550..11841 CDD:185628
PHA03247 <11702..12305 CDD:223021
PspC_subgroup_2 <12149..12512 CDD:411408
PPAK 12629..12654 CDD:397106
Ig 13103..13194 CDD:416386
Ig strand B 13123..13127 CDD:409353
Ig strand C 13136..13139 CDD:409353
Ig strand E 13160..13164 CDD:409353
Ig strand F 13174..13179 CDD:409353
Ig_3 13207..13275 CDD:404760
IG_like 13300..>13364 CDD:214653
Ig 13475..13557 CDD:416386
Ig strand A' 13481..13484 CDD:409353
Ig strand B 13488..13497 CDD:409353
Ig strand C' 13509..13511 CDD:409353
Ig strand D 13517..13522 CDD:409353
Ig strand E 13525..13532 CDD:409353
Ig strand A 13561..13563 CDD:409353
Ig 13562..13645 CDD:416386
Ig strand A' 13565..13571 CDD:409353
Ig strand B 13578..13585 CDD:409353
Ig strand C 13590..13595 CDD:409353
Ig strand C' 13597..13600 CDD:409353
Ig strand D 13605..13609 CDD:409353
Ig strand E 13614..13621 CDD:409353
Ig strand F 13628..13636 CDD:409353
Ig 13650..13733 CDD:416386
Ig strand B 13666..13672 CDD:409353
Ig strand C 13678..13683 CDD:409353
Ig strand C' 13686..13689 CDD:409353
Ig strand D 13694..13699 CDD:409353
Ig strand E 13702..13707 CDD:409353
Ig strand F 13716..13722 CDD:409353
Ig strand G 13725..13733 CDD:409353
Ig 13739..13822 CDD:416386
Ig strand B 13755..13762 CDD:409353
Ig strand C 13767..13772 CDD:409353
Ig strand C' 13774..13777 CDD:409353
Ig strand D 13782..13786 CDD:409353
Ig strand E 13791..13798 CDD:409353
Ig strand F 13805..13813 CDD:409353
Ig strand G 13814..13823 CDD:409353
Ig strand A 13826..13828 CDD:409353
Ig 13829..13903 CDD:416386
Ig strand A' 13830..13837 CDD:409353
Ig strand B 13844..13851 CDD:409353
Ig strand C 13856..13861 CDD:409353
Ig strand C' 13863..13866 CDD:409353
Ig strand D 13871..13875 CDD:409353
Ig strand E 13880..13887 CDD:409353
Ig strand F 13894..13902 CDD:409353
Ig strand A 13916..13918 CDD:409353
Ig 13917..14000 CDD:416386
Ig strand A' 13920..13926 CDD:409353
Ig strand B 13933..13940 CDD:409353
Ig strand C 13946..13950 CDD:409353
Ig strand D 13960..13964 CDD:409353
Ig strand E 13969..13976 CDD:409353
Ig strand F 13983..13991 CDD:409353
Ig 14005..14089 CDD:416386
Ig strand A' 14010..14014 CDD:409353
Ig strand B 14022..14030 CDD:409353
Ig strand C 14035..14039 CDD:409353
Ig strand C' 14042..14044 CDD:409353
Ig strand D 14050..14055 CDD:409353
Ig strand E 14058..14063 CDD:409353
Ig strand G 14079..14089 CDD:409353
Ig 14095..14178 CDD:416386
Ig 14186..14257 CDD:416386
Ig strand A' 14192..14195 CDD:409353
Ig strand B 14199..14205 CDD:409353
Ig strand C 14212..14217 CDD:409353
Ig strand C' 14220..14223 CDD:409353
Ig strand D 14228..14233 CDD:409353
Ig strand E 14236..14241 CDD:409353
Ig strand F 14250..14256 CDD:409353
Ig strand G 14259..14267 CDD:409353
Ig 14273..14356 CDD:416386
Ig strand A' 14276..14282 CDD:409353
Ig strand B 14289..14296 CDD:409353
Ig strand C 14301..14306 CDD:409353
Ig strand C' 14308..14311 CDD:409353
Ig strand D 14316..14320 CDD:409353
Ig strand E 14325..14332 CDD:409353
Ig strand F 14339..14347 CDD:409353
Ig 14362..14433 CDD:416386
Ig strand A' 14365..14371 CDD:409353
Ig strand B 14378..14385 CDD:409353
Ig strand C 14390..14395 CDD:409353
Ig strand C' 14397..14400 CDD:409353
Ig strand D 14405..14409 CDD:409353
Ig strand E 14414..14421 CDD:409353
IG_like 14458..14522 CDD:214653
Ig strand B 14466..14472 CDD:409353
Ig strand C 14479..14484 CDD:409353
Ig strand C' 14487..14490 CDD:409353
Ig strand D 14495..14500 CDD:409353
Ig strand E 14503..14508 CDD:409353
Ig strand F 14517..14523 CDD:409353
Ig strand G 14526..14534 CDD:409353
Ig 14540..14623 CDD:416386
Ig strand A 14542..14545 CDD:409353
Ig strand A' 14547..14551 CDD:409353
Ig strand B 14554..14563 CDD:409353
Ig strand C 14568..14573 CDD:409353
Ig strand C' 14576..14579 CDD:409353
Ig strand D 14583..14588 CDD:409353
Ig strand E 14589..14599 CDD:409353
Ig strand G 14613..14623 CDD:409353
Ig 14629..14717 CDD:416386
Ig strand A' 14631..14637 CDD:409353
Ig strand B 14644..14651 CDD:409353
Ig strand C 14656..14661 CDD:409353
Ig strand C' 14663..14666 CDD:409353
Ig strand D 14671..14675 CDD:409353
Ig strand E 14680..14687 CDD:409353
Ig strand F 14694..14702 CDD:409353
Ig strand G 14705..14717 CDD:409353
Ig 14722..14805 CDD:416386
Ig strand A' 14727..14732 CDD:409353
Ig strand B 14737..14744 CDD:409353
Ig strand C 14750..14756 CDD:409353
Ig strand C' 14757..14760 CDD:409353
Ig strand D 14766..14772 CDD:409353
Ig strand E 14774..14784 CDD:409353
Ig strand G 14795..14805 CDD:409353
Ig 14811..14894 CDD:416386
Ig strand A' 14814..14820 CDD:409353
Ig strand B 14827..14834 CDD:409353
Ig strand C 14839..14844 CDD:409353
Ig strand C' 14846..14849 CDD:409353
Ig strand D 14854..14858 CDD:409353
Ig strand E 14863..14870 CDD:409353
Ig strand F 14877..14885 CDD:409353
Ig 14900..14982 CDD:416386
Ig 14996..15073 CDD:416386
Ig strand A 14996..14999 CDD:409353
Ig strand B 15004..15010 CDD:409353
Ig strand C 15016..15022 CDD:409353
Ig strand D 15031..15036 CDD:409353
Ig strand E 15037..15043 CDD:409353
Ig strand F 15052..15060 CDD:409353
Ig strand G 15063..15073 CDD:409353
FN3 15077..15165 CDD:238020
FN3 15178..15270 CDD:238020
FN3 15279..15366 CDD:238020
Ig 15397..15471 CDD:416386
Ig strand B 15399..15405 CDD:409353
Ig strand C 15411..15417 CDD:409353
Ig strand D 15429..15434 CDD:409353
Ig strand E 15435..15441 CDD:409353
Ig strand F 15450..15458 CDD:409353
Ig strand G 15461..15471 CDD:409353
FN3 15475..15564 CDD:238020
FN3 15575..15664 CDD:238020
Ig 15687..15767 CDD:416386
Ig strand A 15687..15690 CDD:409353
Ig strand B 15695..15701 CDD:409353
Ig strand C 15707..15713 CDD:409353
Ig strand F 31103..31111 CDD:409353
Ig strand G 31114..31124 CDD:409353
FN3 31128..31219 CDD:238020
FN3 31227..31320 CDD:238020
FN3 31329..31419 CDD:238020
Ig_Titin_like 31442..31521 CDD:409406
Ig strand B 31451..31455 CDD:409406
Ig strand C 31464..31468 CDD:409406
Ig strand E 31487..31491 CDD:409406
Ig strand F 31501..31506 CDD:409406
Ig strand G 31514..31517 CDD:409406
FN3 31525..31616 CDD:238020
FN3 31622..31715 CDD:238020
Ig_Titin_like 31734..31815 CDD:409406
Ig strand B 31743..31747 CDD:409406
Ig strand C 31756..31760 CDD:409406
Ig strand E 31781..31785 CDD:409406
Ig strand F 31795..31800 CDD:409406
Ig strand G 31808..31811 CDD:409406
FN3 31819..31910 CDD:238020
FN3 31919..32012 CDD:238020
FN3 32020..32107 CDD:238020
Ig_Titin_like 32133..32211 CDD:409406
Ig strand B 32141..32145 CDD:409406
Ig strand C 32154..32158 CDD:409406
Ig strand E 32177..32181 CDD:409406
Ig strand F 32191..32196 CDD:409406
Ig strand D 15725..15730 CDD:409353
Ig strand E 15731..15737 CDD:409353
Ig strand F 15746..15754 CDD:409353
Ig strand G 15757..15767 CDD:409353
FN3 15771..15862 CDD:238020
FN3 15870..15962 CDD:238020
FN3 15971..16059 CDD:238020
FN3 16071..16157 CDD:238020
FN3 16171..16262 CDD:238020
FN3 16272..16363 CDD:238020
Ig 16383..16463 CDD:416386
Ig strand A 16383..16386 CDD:409353
Ig strand B 16391..16397 CDD:409353
Ig strand C 16403..16409 CDD:409353
Ig strand D 16421..16426 CDD:409353
Ig strand E 16427..16433 CDD:409353
Ig strand F 16442..16450 CDD:409353
Ig strand G 16453..16463 CDD:409353
FN3 16467..16553 CDD:238020
FN3 16572..16659 CDD:238020
Ig 16678..16785 CDD:416386
Ig strand B 16684..16690 CDD:409353
Ig strand C 16696..16702 CDD:409353
Ig strand D 16742..16747 CDD:409353
Ig strand E 16748..16755 CDD:409353
Ig strand F 16764..16772 CDD:409353
Ig strand G 16775..16785 CDD:409353
FN3 16789..16880 CDD:238020
FN3 16890..16982 CDD:238020
FN3 16996..17082 CDD:238020
Ig 17105..17180 CDD:416386
Ig strand B 17109..17115 CDD:409353
Ig strand C 17121..17127 CDD:409353
Ig strand D 17138..17143 CDD:409353
Ig strand E 17144..17150 CDD:409353
Ig strand F 17159..17167 CDD:409353
Ig strand G 17170..17180 CDD:409353
FN3 17184..17273 CDD:238020
FN3 17282..17374 CDD:238020
Ig 17394..17481 CDD:416386
Ig strand A 17394..17398 CDD:409353
Ig strand B 17403..17409 CDD:409353
Ig strand C 17415..17421 CDD:409353
Ig strand D 17434..17439 CDD:409353
Ig strand E 17440..17451 CDD:409353
Ig strand F 17460..17468 CDD:409353
Ig strand G 17471..17481 CDD:409353
FN3 17485..17569 CDD:214495
FN3 17586..17680 CDD:238020
FN3 17692..17783 CDD:238020
Ig_Titin_like 17806..17895 CDD:409406
Ig strand B 17815..17819 CDD:409406
Ig strand C 17828..17832 CDD:409406
Ig strand E 17861..17865 CDD:409406
Ig strand F 17875..17880 CDD:409406
Ig strand G 17888..17891 CDD:409406
FN3 17899..17991 CDD:238020
FN3 18004..18093 CDD:238020
Ig 18115..18200 CDD:416386
Ig strand B 18121..18127 CDD:409353
Ig strand C 18133..18144 CDD:409353
Ig strand D 18158..18163 CDD:409353
Ig strand E 18164..18170 CDD:409353
Ig strand F 18179..18187 CDD:409353
Ig strand G 18190..18200 CDD:409353
FN3 18204..18296 CDD:238020
FN3 18304..18401 CDD:238020
FN3 18415..18500 CDD:238020
Ig_Titin_like 18520..18599 CDD:409406
Ig strand B 18529..18533 CDD:409406
Ig strand C 18542..18546 CDD:409406
Ig strand E 18565..18569 CDD:409406
Ig strand F 18579..18584 CDD:409406
Ig strand G 18592..18595 CDD:409406
FN3 18603..18691 CDD:238020
FN3 18704..18797 CDD:238020
Ig 18815..18895 CDD:416386
Ig strand A 18815..18818 CDD:409353
Ig strand B 18823..18829 CDD:409353
Ig strand C 18835..18841 CDD:409353
Ig strand D 18853..18858 CDD:409353
Ig strand E 18859..18865 CDD:409353
Ig strand F 18874..18882 CDD:409353
Ig strand G 18885..18895 CDD:409353
FN3 18899..18991 CDD:238020
FN3 18999..19088 CDD:238020
FN3 19100..19188 CDD:238020
Ig 19216..19293 CDD:416386
Ig strand B 19223..19229 CDD:409353
Ig strand C 19235..19241 CDD:409353
Ig strand D 19251..19256 CDD:409353
Ig strand E 19257..19263 CDD:409353
Ig strand F 19272..19280 CDD:409353
Ig strand G 19283..19293 CDD:409353
FN3 19297..19384 CDD:238020
FN3 19397..19486 CDD:238020
Ig 19507..19587 CDD:416386
Ig strand A 19507..19510 CDD:409353
Ig strand B 19515..19521 CDD:409353
Ig strand C 19527..19533 CDD:409353
Ig strand D 19545..19550 CDD:409353
Ig strand E 19551..19557 CDD:409353
Ig strand F 19566..19574 CDD:409353
Ig strand G 19577..19587 CDD:409353
FN3 19591..19683 CDD:238020
FN3 19691..19782 CDD:238020
FN3 19791..19877 CDD:238020
Ig 19904..19985 CDD:416386
Ig strand A 19904..19908 CDD:409353
Ig strand B 19913..19919 CDD:409353
Ig strand C 19925..19931 CDD:409353
Ig strand D 19943..19948 CDD:409353
Ig strand E 19949..19955 CDD:409353
Ig strand F 19964..19972 CDD:409353
Ig strand G 19975..19985 CDD:409353
FN3 19989..20079 CDD:238020
FN3 20088..20181 CDD:238020
Ig 20188..20281 CDD:416386
Ig strand A 20188..20190 CDD:409353
Ig strand A' 20193..20198 CDD:409353
Ig strand B 20206..20214 CDD:409353
Ig strand C 20219..20223 CDD:409353
Ig strand C' 20227..20229 CDD:409353
Ig strand D 20236..20242 CDD:409353
Ig strand E 20245..20250 CDD:409353
Ig strand F 20259..20267 CDD:409353
Ig strand G 20270..20281 CDD:409353
FN3 20284..20375 CDD:238020
FN3 20383..20476 CDD:238020
FN3 20484..20582 CDD:238020
Ig_Titin_like 20603..20682 CDD:409406
Ig strand B 20611..20615 CDD:409406
Ig strand C 20624..20628 CDD:409406
Ig strand E 20648..20652 CDD:409406
Ig strand F 20662..20667 CDD:409406
Ig strand G 20675..20678 CDD:409406
FN3 20686..20772 CDD:238020
FN3 20786..20869 CDD:238020
Ig 20895..20975 CDD:416386
Ig strand A 20895..20898 CDD:409353
Ig strand B 20903..20909 CDD:409353
Ig strand C 20915..20921 CDD:409353
Ig strand D 20933..20938 CDD:409353
Ig strand E 20939..20945 CDD:409353
Ig strand F 20954..20962 CDD:409353
Ig strand G 20965..20975 CDD:409353
FN3 20979..21067 CDD:238020
FN3 21079..21172 CDD:238020
FN3 21178..21272 CDD:238020
Ig 21292..21372 CDD:416386
Ig strand A 21292..21295 CDD:409353
Ig strand B 21300..21306 CDD:409353
Ig strand C 21312..21318 CDD:409353
Ig strand D 21330..21335 CDD:409353
Ig strand E 21336..21342 CDD:409353
Ig strand F 21351..21359 CDD:409353
Ig strand G 21362..21372 CDD:409353
FN3 21376..21467 CDD:238020
FN3 21475..21567 CDD:238020
FN3 21576..21664 CDD:238020
Ig_Titin_like 21689..21770 CDD:409406
Ig strand B 21698..21702 CDD:409406
Ig strand C 21711..21715 CDD:409406
Ig strand E 21736..21740 CDD:409406
Ig strand F 21750..21755 CDD:409406
Ig strand G 21763..21766 CDD:409406
FN3 21774..21865 CDD:238020
FN3 21871..21955 CDD:238020
Ig_Titin_like 21978..22059 CDD:409406
Ig strand B 21987..21991 CDD:409406
Ig strand C 22000..22004 CDD:409406
Ig strand E 22025..22029 CDD:409406
Ig strand F 22039..22044 CDD:409406
Ig strand G 22052..22055 CDD:409406
FN3 22063..22155 CDD:238020
FN3 22163..22256 CDD:238020
FN3 22262..22351 CDD:238020
Ig 22375..22456 CDD:416386
Ig strand A 22375..22378 CDD:409353
Ig strand B 22383..22390 CDD:409353
Ig strand C 22396..22402 CDD:409353
Ig strand D 22414..22419 CDD:409353
Ig strand E 22420..22426 CDD:409353
Ig strand F 22435..22443 CDD:409353
Ig strand G 22446..22456 CDD:409353
FN3 22460..22551 CDD:238020
FN3 22566..22649 CDD:238020
FN3 22660..22747 CDD:238020
Ig_Titin_like 22772..22851 CDD:409406
Ig strand B 22781..22785 CDD:409406
Ig strand C 22794..22798 CDD:409406
Ig strand E 22817..22821 CDD:409406
Ig strand F 22831..22836 CDD:409406
Ig strand G 22844..22847 CDD:409406
FN3 22855..22944 CDD:238020
FN3 22952..23043 CDD:238020
Ig_Titin_like 23062..23142 CDD:409406
Ig strand B 23070..23074 CDD:409406
Ig strand C 23083..23087 CDD:409406
Ig strand E 23108..23112 CDD:409406
Ig strand F 23122..23127 CDD:409406
Ig strand G 23135..23138 CDD:409406
FN3 23146..23238 CDD:238020
FN3 23246..23336 CDD:238020
FN3 23345..23438 CDD:238020
Ig 23457..23538 CDD:416386
Ig strand A 23457..23461 CDD:409353
Ig strand B 23466..23472 CDD:409353
Ig strand C 23478..23484 CDD:409353
Ig strand D 23496..23501 CDD:409353
Ig strand E 23502..23508 CDD:409353
Ig strand F 23517..23525 CDD:409353
Ig strand G 23528..23538 CDD:409353
FN3 23542..23633 CDD:238020
FN3 23642..23734 CDD:238020
FN3 23743..23830 CDD:238020
Ig_Titin_like 23856..23935 CDD:409406
Ig strand B 23865..23869 CDD:409406
Ig strand C 23878..23882 CDD:409406
Ig strand E 23901..23905 CDD:409406
Ig strand F 23915..23920 CDD:409406
Ig strand G 23928..23931 CDD:409406
FN3 23939..24028 CDD:238020
FN3 24036..24119 CDD:238020
Ig_Titin_like 24143..24224 CDD:409406
Ig strand B 24152..24156 CDD:409406
Ig strand C 24165..24169 CDD:409406
Ig strand E 24190..24194 CDD:409406
Ig strand F 24204..24209 CDD:409406
Ig strand G 24217..24220 CDD:409406
FN3 24228..24320 CDD:238020
FN3 24328..24420 CDD:238020
FN3 24427..24520 CDD:238020
Ig_Titin_like 24539..24620 CDD:409406
Ig strand B 24548..24552 CDD:409406
Ig strand C 24561..24565 CDD:409406
Ig strand E 24586..24590 CDD:409406
Ig strand F 24600..24605 CDD:409406
Ig strand G 24613..24616 CDD:409406
FN3 24624..24716 CDD:238020
FN3 24724..24813 CDD:238020
FN3 24825..24913 CDD:238020
Ig_Titin_like 24938..25017 CDD:409406
Ig strand B 24947..24951 CDD:409406
Ig strand C 24960..24964 CDD:409406
Ig strand E 24983..24987 CDD:409406
Ig strand F 24997..25002 CDD:409406
Ig strand G 25010..25013 CDD:409406
FN3 25021..25108 CDD:238020
FN3 25118..25201 CDD:238020
Ig 25226..25305 CDD:416386
Ig strand A 25226..25229 CDD:409353
Ig strand B 25234..25240 CDD:409353
Ig strand C 25246..25252 CDD:409353
Ig strand D 25264..25269 CDD:409353
Ig strand E 25270..25276 CDD:409353
Ig strand F 25285..25293 CDD:409353
Ig strand G 25296..25305 CDD:409353
FN3 25310..25402 CDD:238020
FN3 25410..25503 CDD:238020
FN3 25509..25602 CDD:238020
Ig 25621..25702 CDD:416386
Ig strand A 25621..25625 CDD:409353
Ig strand B 25630..25636 CDD:409353
Ig strand C 25642..25648 CDD:409353
Ig strand D 25660..25665 CDD:409353
Ig strand E 25666..25672 CDD:409353
Ig strand F 25681..25689 CDD:409353
Ig strand G 25692..25702 CDD:409353
FN3 25706..25797 CDD:238020
FN3 25806..25896 CDD:238020
FN3 25907..25995 CDD:238020
Ig_Titin_like 26021..26099 CDD:409406
Ig strand B 26029..26033 CDD:409406
Ig strand C 26042..26046 CDD:409406
Ig strand E 26065..26069 CDD:409406
Ig strand F 26079..26084 CDD:409406
Ig strand G 26092..26095 CDD:409406
FN3 26103..26194 CDD:238020
FN3 26200..26283 CDD:238020
Ig_Titin_like 26307..26388 CDD:409406
Ig strand B 26316..26320 CDD:409406
Ig strand C 26329..26333 CDD:409406
Ig strand E 26354..26358 CDD:409406
Ig strand F 26368..26373 CDD:409406
Ig strand G 26381..26384 CDD:409406
FN3 26392..26485 CDD:238020
FN3 26492..26585 CDD:238020
FN3 26591..26684 CDD:238020
Ig 26703..26785 CDD:416386
Ig strand A 26703..26707 CDD:409353
Ig strand B 26712..26718 CDD:409353
Ig strand C 26724..26730 CDD:409353
Ig strand D 26743..26748 CDD:409353
Ig strand E 26749..26755 CDD:409353
Ig strand F 26764..26772 CDD:409353
Ig strand G 26775..26785 CDD:409353
FN3 26789..26881 CDD:238020
FN3 26889..26981 CDD:238020
FN3 26990..27078 CDD:238020
Ig_Titin_like 27103..27182 CDD:409406
Ig strand B 27112..27116 CDD:409406
Ig strand C 27125..27129 CDD:409406
Ig strand E 27148..27152 CDD:409406
Ig strand F 27162..27167 CDD:409406
Ig strand G 27175..27178 CDD:409406
FN3 27186..27275 CDD:238020
FN3 27283..27366 CDD:238020
Ig_Titin_like 27390..27471 CDD:409406
Ig strand B 27399..27403 CDD:409406
Ig strand C 27412..27416 CDD:409406
Ig strand E 27437..27441 CDD:409406
Ig strand F 27451..27456 CDD:409406
Ig strand G 27464..27467 CDD:409406
FN3 27475..27566 CDD:238020
FN3 27574..27658 CDD:238020
FN3 27673..27766 CDD:238020
Ig_Titin_like 27785..27866 CDD:409406
Ig strand B 27794..27798 CDD:409406
Ig strand C 27807..27811 CDD:409406
Ig strand E 27832..27836 CDD:409406
Ig strand F 27846..27851 CDD:409406
Ig strand G 27859..27862 CDD:409406
FN3 27870..27962 CDD:238020
FN3 27970..28060 CDD:238020
FN3 28071..28163 CDD:238020
Ig_Titin_like 28182..28261 CDD:409406
Ig strand B 28191..28195 CDD:409406
Ig strand C 28204..28208 CDD:409406
Ig strand E 28227..28231 CDD:409406
Ig strand F 28241..28246 CDD:409406
Ig strand G 28254..28257 CDD:409406
FN3 28265..28356 CDD:238020
FN3 28362..28445 CDD:238020
Ig_Titin_like 28472..28553 CDD:409406
Ig strand B 28481..28485 CDD:409406
Ig strand C 28494..28498 CDD:409406
Ig strand E 28519..28523 CDD:409406
Ig strand F 28533..28538 CDD:409406
Ig strand G 28546..28549 CDD:409406
FN3 28557..28650 CDD:238020
FN3 28657..28747 CDD:238020
FN3 28756..28849 CDD:238020
Ig_Titin_like 28868..28949 CDD:409406
Ig strand B 28877..28881 CDD:409406
Ig strand C 28890..28894 CDD:409406
Ig strand E 28915..28919 CDD:409406
Ig strand F 28929..28934 CDD:409406
Ig strand G 28942..28945 CDD:409406
FN3 28953..29045 CDD:238020
FN3 29053..29145 CDD:238020
FN3 29154..29245 CDD:238020
Ig_Titin_like 29268..29349 CDD:409406
Ig strand B 29276..29280 CDD:409406
Ig strand C 29289..29293 CDD:409406
Ig strand E 29314..29318 CDD:409406
Ig strand F 29328..29333 CDD:409406
Ig strand G 29342..29345 CDD:409406
FN3 29353..29442 CDD:238020
FN3 29450..29541 CDD:238020
Ig 29560..29627 CDD:416386
Ig strand A 29560..29563 CDD:409353
Ig strand B 29568..29574 CDD:409353
Ig strand C 29580..29586 CDD:409353
Ig strand D 29598..29603 CDD:409353
Ig strand E 29604..29610 CDD:409353
Ig strand F 29619..29627 CDD:409353
FN3 29644..29736 CDD:238020
FN3 29744..29836 CDD:238020
FN3 29843..29931 CDD:238020
Ig 29955..30035 CDD:416386
Ig strand A 29955..29958 CDD:409353
Ig strand B 29963..29969 CDD:409353
Ig strand C 29975..29981 CDD:409353
Ig strand D 29991..29996 CDD:409353
Ig strand E 29997..30005 CDD:409353
Ig strand F 30014..30022 CDD:409353
Ig strand G 30025..30035 CDD:409353
FN3 30046..30131 CDD:238020
FN3 30139..30226 CDD:238020
FN3 30241..30330 CDD:238020
Ig_Titin_like 30353..30432 CDD:409406
Ig strand B 30362..30366 CDD:409406
Ig strand C 30375..30379 CDD:409406
Ig strand E 30398..30402 CDD:409406
Ig strand F 30412..30417 CDD:409406
Ig strand G 30425..30428 CDD:409406
FN3 30436..30520 CDD:238020
FN3 30533..30616 CDD:238020
Ig_Titin_like 30644..30724 CDD:409406
Ig strand B 30652..30656 CDD:409406
Ig strand C 30665..30669 CDD:409406
Ig strand E 30690..30694 CDD:409406
Ig strand F 30704..30709 CDD:409406
Ig strand G 30717..30720 CDD:409406
FN3 30728..30820 CDD:238020
FN3 30828..30920 CDD:238020
FN3 30927..31023 CDD:238020
Ig 31044..31124 CDD:416386
Ig strand A 31044..31047 CDD:409353
Ig strand B 31052..31058 CDD:409353
Ig strand C 31064..31070 CDD:409353
Ig strand D 31082..31087 CDD:409353
Ig strand E 31088..31094 CDD:409353
Ig strand G 32204..32207 CDD:409406
FN3 32215..32305 CDD:238020 4/24 (17%)
FN3 32325..32410 CDD:238020 33/84 (39%)
FN3 32418..32503 CDD:238020 4/84 (5%)
I-set 32528..32607 CDD:400151 24/78 (31%)
Ig strand B 32537..32541 CDD:409353 0/3 (0%)
Ig strand C 32550..32554 CDD:409353 1/3 (33%)
Ig strand E 32575..32579 CDD:409353 1/3 (33%)
Ig strand F 32589..32594 CDD:409353 1/4 (25%)
Ig 32629..32704 CDD:416386 23/74 (31%)
Ig strand B 32633..32639 CDD:409353 4/5 (80%)
Ig strand C 32645..32651 CDD:409353 4/5 (80%)
Ig strand D 32663..32668 CDD:409353 1/4 (25%)
Ig strand E 32669..32675 CDD:409353 1/5 (20%)
Ig strand F 32685..32693 CDD:409353 3/7 (43%)
Ig strand G 32696..32704 CDD:409353 1/7 (14%)
FN3 32710..32803 CDD:238020 32/97 (33%)
FN3 32812..32905 CDD:238020 18/116 (16%)
Ig 32915..33007 CDD:416386 18/100 (18%)
Ig strand A 32915..32917 CDD:409353 1/1 (100%)
Ig strand A' 32919..32925 CDD:409353 1/5 (20%)
Ig strand B 32932..32939 CDD:409353 1/6 (17%)
Ig strand C 32945..32950 CDD:409353 1/6 (17%)
Ig strand C' 32952..32955 CDD:409353 0/2 (0%)
Ig strand D 32961..32965 CDD:409353 0/3 (0%)
Ig strand E 32971..32978 CDD:409353 1/6 (17%)
Ig strand F 32985..32993 CDD:409353 0/7 (0%)
Ig strand G 32996..33007 CDD:409353 1/10 (10%)
Ig_Titin_like 33024..33105 CDD:409406 15/82 (18%)
Ig strand B 33032..33036 CDD:409406 0/3 (0%)
Ig strand C 33045..33049 CDD:409406 0/3 (0%)
Ig strand E 33070..33074 CDD:409406 0/3 (0%)
Ig strand F 33085..33090 CDD:409406 0/4 (0%)
Ig strand G 33098..33101 CDD:409406 1/2 (50%)
FN3 33109..33200 CDD:238020 21/107 (20%)
STKc_Titin 33237..33513 CDD:271006 59/306 (19%)
IgI_Titin_M1-like 33556..33645 CDD:409521
Ig strand B 33572..33576 CDD:409521
Ig strand C 33586..33590 CDD:409521
Ig strand E 33611..33615 CDD:409521
Ig strand F 33625..33630 CDD:409521
Ig strand G 33638..33641 CDD:409521
I-set 33676..33768 CDD:400151
Ig strand A 33676..33678 CDD:409353
Ig strand A' 33680..33686 CDD:409353
Ig strand B 33693..33700 CDD:409353
Ig strand C 33706..33711 CDD:409353
Ig strand C' 33713..33716 CDD:409353
Ig strand D 33724..33728 CDD:409353
Ig strand E 33733..33740 CDD:409353
Ig strand F 33747..33755 CDD:409353
Ig strand G 33758..33768 CDD:409353
I-set 33781..33871 CDD:400151
Ig strand A' 33786..33790 CDD:409353
Ig strand B 33798..33806 CDD:409353
Ig strand C 33811..33816 CDD:409353
Ig strand C' 33819..33821 CDD:409353
Ig strand D 33827..33832 CDD:409353
Ig strand E 33836..33841 CDD:409353
Ig strand F 33850..33858 CDD:409353
Ig strand G 33861..33871 CDD:409353
Ig 34361..34450 CDD:416386
Ig strand A 34361..34363 CDD:409353
Ig strand A' 34365..34371 CDD:409353
Ig strand B 34378..34385 CDD:409353
Ig strand C 34391..34396 CDD:409353
Ig strand C' 34398..34401 CDD:409353
Ig strand D 34406..34410 CDD:409353
Ig strand E 34415..34422 CDD:409353
Ig strand F 34429..34437 CDD:409353
Ig strand G 34440..34450 CDD:409353
PTZ00121 <34455..35189 CDD:173412
IgI_Titin_like 34545..34636 CDD:143224
Ig strand B 34565..34569 CDD:143224
Ig strand C 34578..34582 CDD:143224
Ig strand E 34603..34607 CDD:143224
Ig strand F 34617..34622 CDD:143224
Ig strand G 34630..34633 CDD:143224
Ig 34705..34794 CDD:416386
Ig strand B 34720..34724 CDD:409353
Ig strand C 34735..34739 CDD:409353
Ig strand E 34761..34765 CDD:409353
Ig strand F 34775..34780 CDD:409353
Ig strand A 34884..34891 CDD:409353
I-set 34891..34980 CDD:400151
Ig strand A' 34898..34903 CDD:409353
Ig strand B 34908..34916 CDD:409353
Ig strand C 34920..34926 CDD:409353
Ig strand C' 34928..34930 CDD:409353
Ig strand D 34936..34942 CDD:409353
Ig strand E 34945..34951 CDD:409353
Ig strand F 34960..34967 CDD:409353
Ig strand G 34970..34979 CDD:409353
I-set 35173..35262 CDD:400151
Ig strand A 35173..35175 CDD:409353
Ig strand A' 35177..35183 CDD:409353
Ig strand B 35190..35197 CDD:409353
Ig strand C 35203..35208 CDD:409353
Ig strand C' 35210..35213 CDD:409353
Ig strand E 35227..35234 CDD:409353
Ig strand F 35241..35249 CDD:409353
Ig strand G 35252..35262 CDD:409353
I-set 35368..35460 CDD:400151
Ig strand A 35377..35380 CDD:409353
Ig strand B 35385..35391 CDD:409353
Ig strand C 35397..35403 CDD:409353
Ig strand D 35418..35423 CDD:409353
Ig strand E 35424..35430 CDD:409353
Ig strand F 35439..35447 CDD:409353
Ig strand G 35450..35458 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10261
eggNOG 1 0.900 - - E1_KOG0613
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.