DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and oig-2

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:NP_496767.1 Gene:oig-2 / 189675 WormBaseID:WBGene00003860 Length:108 Species:Caenorhabditis elegans


Alignment Length:96 Identity:28/96 - (29%)
Similarity:40/96 - (41%) Gaps:12/96 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 MVQAPPKIRLPRTYEDGLIVEADEVLRLKVGVAGQPPPAITWLHEGEVIAPGGRFEVSNTEK--- 287
            ||.||...:.|     .||:..|..:..:......|.|.:.|..:.:.:. |.|: ||..:|   
 Worm     1 MVLAPFFEKAP-----SLIIAPDGSVLFECICNANPQPTVKWFLKDKELT-GDRY-VSKIKKMVG 58

  Fly   288 --NSLLKIDNVLREDRGEYMVKAWNRLGEDS 316
              ...|.|.|..:||:|.|.|.|.|..|..|
 Worm    59 KFTVTLHIKNPTQEDQGVYKVTATNTHGSHS 89

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020