DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and AgaP_AGAP006746

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:XP_308996.3 Gene:AgaP_AGAP006746 / 1270312 VectorBaseID:AGAP006746 Length:344 Species:Anopheles gambiae


Alignment Length:152 Identity:35/152 - (23%)
Similarity:57/152 - (37%) Gaps:35/152 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 LKIDNVLREDRGEYMVKAWNRLGEDSTSFLVTVTARPNPPGTPKLNMSFGKSATLSWTAPLDDGG 355
            :|.:|:|      .:.|..||:......|     ||...|| .||.:.||   |..:.||     
Mosquito   162 MKPENIL------CLTKTGNRIKIIDFGF-----ARRYDPG-KKLQVMFG---TAEFAAP----- 206

  Fly   356 CKIGNYIVEYFRVGWNVWLKAATTRALSTTLHDLIEGSE-----------YKFRVKAENPYGLSE 409
             ::.|:...||..  ::|........|.:.|...:.|.:           |.|..|:.:....|.
Mosquito   207 -EVLNFDEIYFYT--DMWSLGVICYVLLSGLSPFVGGDDQATMTNVLQGAYTFDYKSFDAVSDSA 268

  Fly   410 PSGESELLFIPDPKRGITKPKS 431
            .....:|| :.|.:|.:|..|:
Mosquito   269 KDFVRKLL-VRDGERRLTARKA 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020
I-set 138..227 CDD:254352
Ig 155..224 CDD:143165
IG_like 243..323 CDD:214653 7/31 (23%)
Ig 250..323 CDD:299845 7/31 (23%)
FN3 327..411 CDD:238020 20/94 (21%)
AgaP_AGAP006746XP_308996.3 S_TKc 40..295 CDD:214567 35/152 (23%)
PKc_like 46..295 CDD:304357 35/152 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0613
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.