DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and Mybpc1

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:XP_006513108.1 Gene:Mybpc1 / 109272 MGIID:1336213 Length:1196 Species:Mus musculus


Alignment Length:542 Identity:141/542 - (26%)
Similarity:217/542 - (40%) Gaps:122/542 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NQPGKLHTHPQGGRPKKNVHWKSAERPSPPGRPILTPVALPEQQPDVVNLRWDRPLHDGGSPITG 67
            |:.|:.|.         ::..|..:.|.||..|.:|.|.     .|...:.|:.|.:||||||.|
Mouse   629 NEAGEAHA---------SIKIKVVDIPDPPVAPNVTEVG-----DDWCIMNWEPPAYDGGSPILG 679

  Fly    68 YTVEHRRMGSPHWVRATPTPVDRCDVC-ISGLEP-----GWRYQFRCFAENIVGRSDASELSDPL 126
            |.:|.::..|..|:|.      ..|:| .:..||     |..|:.|.||.|.:|.|..|..|.|.
Mouse   680 YFIERKKKQSSRWMRL------NFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSKPF 738

  Fly   127 TVTLQRNAITVPRFIDELVDTNAVEDERIEFRVRILGEPPPEINWF-KDGYEI----FSSRRTKI 186
             |.|   |:|.|   ..|:..::|.|..:..:.|    ||.:|... .|||.:    ..|...|.
Mouse   739 -VPL---AVTSP---PTLLAVDSVTDSSVTMKWR----PPDQIGAAGLDGYVLEYCFEGSTSAKQ 792

  Fly   187 VNDN-------EASVLVIHQVALTDEGE-------------IKCTATNRAG---------HVITK 222
            .|:|       .|...::....|.|:.:             ::..|.|.||         .::.|
Mouse   793 SNENGETACDLPAEDWIVANTDLIDKTKFTINGLPTDAKIFVRVKAINAAGASEPKYYSQPILVK 857

  Fly   223 ARLMVQAPPKIRLPRTYEDGLIVEADEVLRLKVGVAGQPPPAITWLHEGEVIAPGGRFEVSNTEK 287
            .   :..|||||:||..:...|....|.:.|.:...|:|.|.:||..:||.| ...:..:.|:|.
Mouse   858 E---IIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGEEI-DKNQINIRNSET 918

  Fly   288 NSLLKIDNVLREDRGEYMVKAWNRLGEDSTSFLVTVTARPNPPGTPKLNMSFGKSATLSWTAPLD 352
            ::::.|....|...|:|.::.......::.|..:.:..||.||.|..:...:|::..|:||.|.|
Mouse   919 DTIIFIRKAERSHSGKYDLQVKVDKYVENASIDIQIVDRPGPPQTVTIEDVWGENVALTWTPPKD 983

  Fly   353 DGGCKIGNYIV--------EYFRVGWNVWLKAATTRALSTTLHDLIEGSEYKFRVKAENPYGLSE 409
            ||...|..|.:        |:|.|       .......:.|:.:|:.|:||.|||.|||..||||
Mouse   984 DGNAAITGYTIQKADKKSMEWFTV-------IEHYHRTNATITELVIGNEYYFRVFAENMCGLSE 1041

  Fly   410 PSGESELLFIPDPKRGITKPKSATRIAGDEK--------DKPKTGAGGMQVPPRRKTLSPPRPQA 466
            .:               |..|.:..||.|.|        |...|.|         ...:.|....
Mouse  1042 DA---------------TMTKESAVIAKDGKIYKNPVYEDFNFTEA---------PMFTQPLVNT 1082

  Fly   467 DASTGMSPKQSPSAKRKPKPQL 488
            .|..|.:...:.|.:..|||::
Mouse  1083 YAIAGYNATLNCSVRGNPKPKI 1104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020 36/103 (35%)
I-set 138..227 CDD:254352 23/122 (19%)
Ig 155..224 CDD:143165 19/102 (19%)
IG_like 243..323 CDD:214653 18/79 (23%)
Ig 250..323 CDD:299845 16/72 (22%)
FN3 327..411 CDD:238020 32/91 (35%)
Mybpc1XP_006513108.1 IG_like 90..185 CDD:214653
THB 235..268 CDD:375788
Ig 280..363 CDD:386229
Ig 370..454 CDD:386229
Ig 460..530 CDD:386229
Ig_C5_MyBP-C 557..642 CDD:143302 3/21 (14%)
FN3 646..735 CDD:238020 34/99 (34%)
FN3 745..847 CDD:238020 22/108 (20%)
Ig 882..>940 CDD:386229 15/58 (26%)
FN3 958..1041 CDD:238020 30/89 (34%)
I-set 1073..1162 CDD:369462 7/32 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000709
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X825
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.