powered by:
Protein Alignment CG14964 and LOC101730761
DIOPT Version :9
Sequence 1: | NP_647779.2 |
Gene: | CG14964 / 38384 |
FlyBaseID: | FBgn0035410 |
Length: | 1443 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004919903.1 |
Gene: | LOC101730761 / 101730761 |
-ID: | - |
Length: | 130 |
Species: | Xenopus tropicalis |
Alignment Length: | 56 |
Identity: | 12/56 - (21%) |
Similarity: | 25/56 - (44%) |
Gaps: | 4/56 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 801 LYERAMARFYEAVELEQASKSRKTSRDKLVTP----VPHQTPANLRKRLGSISEAE 852
:|..|:..:..|..||.|..:.:.::...:.| :..:....|.|.||.::.|:
Frog 50 VYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQ 105
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000709 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.