DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and mybpc1

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:XP_031754721.1 Gene:mybpc1 / 100487880 XenbaseID:XB-GENE-486401 Length:1528 Species:Xenopus tropicalis


Alignment Length:992 Identity:213/992 - (21%)
Similarity:332/992 - (33%) Gaps:256/992 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VNLRWDRPLHDGGS---PITGYTVEHR--------------------------RMGSPHWVRATP 85
            |.|:|    :..|.   |.|.|..||:                          :..:..:||..|
 Frog   394 VELKW----YKNGQEIRPSTKYIFEHKGNQRILFVNNCTLADDAAYQVCAGDEKCSTELFVREPP 454

  Fly    86 TPV------------DR----CDVCISGLEPGW-------------RYQFRCFAENIVGRSDASE 121
            ..|            ||    |:|........|             ||:.:...:......|.:.
 Frog   455 ILVTKELENVNSYCGDRVELECEVSDEDANVKWFKNGVELTNEARSRYRLKVDGKKHTLIIDEAN 519

  Fly   122 LSDPLTVTLQRNA----------ITVPRFIDELVDTNAVEDERIEFRVRILGEPPPEINWFKDGY 176
            ..|..|.::....          :...:.:..|.|:.....:.|..:..|....|.  .|:::|.
 Frog   520 RGDSATYSVMTTGGQSAAQLQVDLRPLKILQPLTDSTVNLGKEINLKCEISENVPG--RWYRNGQ 582

  Fly   177 EIFSSRRTKIVNDNEASVLVIHQVALTDEGEIKCT----ATNRAGHVITKARLMVQAPPKIRLPR 237
            .|..|.|.||.:......|||....:.|||:....    .||      ..|.:.|..||||....
 Frog   583 LIQGSDRVKIFHKGRIHRLVIESALVEDEGDYSFVPDLYLTN------IPANVHVIDPPKIHFDA 641

  Fly   238 -TYEDGLI-VEADEVLRLKVGVAGQPPPAITWLHEGEVIAP-GGRFEVSNTEKNSLLKIDNVLRE 299
             :|.|..: |.|...|||:|.|.|:|.|.|.|....:.|.. .||....:...:.||.||:..||
 Frog   642 LSYPDNTVTVVAGTKLRLEVPVTGEPAPKIIWSRGDKWITELSGRIRAESYPDHGLLVIDSAERE 706

  Fly   300 DRGEYMVKAWNRLGEDSTSFLVTVTARPNPPGTPKLNMSFGKSATLSWTAPLDDGGCKIGNYIVE 364
            |.|.|.:...|..||......:.|...|:||..|.:........|:.|..|:.||||.|..|.:|
 Frog   707 DSGTYRIMVKNEAGEAVAHIKIKVVDIPDPPPAPDVTEVGEDWCTMKWDPPIYDGGCPILGYFIE 771

  Fly   365 YFRVGWNVWLKAATTRALSTTLH--DLIEGSEYKFRVKAENPYGLSEPSGESELLFIPDPKRGIT 427
            ..:...:.|::........||..  .:|||..|:.||.|.|..|.|:||..|: .|:|   ..:|
 Frog   772 RKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRVFAVNSIGTSKPSPPSK-AFVP---LAVT 832

  Fly   428 KPKSATRIAG------DEKDKP--KTGAGGMQVPPRRKTLSPPRPQADA-------STGMSPKQS 477
            ...:...:.|      ..|.:|  ..||.|:                |.       ..|...||.
 Frog   833 SAPTMLTVDGVTDNSVTMKWRPPDHIGAAGL----------------DGYVIEYCFEGGGDEKQK 881

  Fly   478 PSAKRKPKPQLIDNEQLTHEMSYGTSDHALKM------------------DVRKSPSLNSADSAN 524
            |........||:|          |.|.|..::                  |::  ..||:....|
 Frog   882 PEFSENEMEQLVD----------GVSKHGQQLCGGLAAKTTKAEKSKIWADIQ--AKLNAVGGQN 934

  Fly   525 KPTTD--------SSNPKLNLTLVTTTLAPLDKSVPSPKAPRTPATSPLK-----LFNPKPSGAP 576
            :...|        ..:.|..::.:......:.:.||:|  |:....|..|     |...:..|.|
 Frog   935 RSIADIKKEWNNLKKHTKDKMSQIKQESTEVSEGVPAP--PQQELNSLEKRVEAMLQLEQTEGTP 997

  Fly   577 KDRSPVQP------KPQPLPTPP-----METPDKASPNPKRSLSPPNKRQPPPLRKSPTPPEPIK 630
            .....:|.      ..:|:.|..     ::..||..|    .|..|:..|.....|.....:..|
 Frog   998 GIDDDLQDDVTGGGAAKPVFTDEELSALVDNIDKFGP----QLFGPSTAQSSAADKDKIWADIQK 1058

  Fly   631 VTPAL---LRSAEPVQLGVNQNVRRFSGQTLSPARNVPTLALAVASGVSAVIGEKLP-----TIE 687
            ...|:   .||.|.::...|:..|    ||.....:..|.||..:.|..:...|..|     .:.
 Frog  1059 HINAVGGNNRSIEDIKKAWNKLKR----QTKKKIEHNKTQALLESKGQPSQYHELTPIEKRVEVI 1119

  Fly   688 ISAPPTPQEE---EPPVLER--SPSPEPAPKSQSNARRFSRSADKHDDVHTSNEFMLVVFDKNSK 747
            :......:|:   ||...|.  ..:|||..|:     ||:.:.     :.|.::..:.|...|:.
 Frog  1120 LQIKEIDEEDFHGEPEEAEEWLVANPEPTDKT-----RFTITG-----LPTGSKIFVRVKALNAA 1174

  Fly   748 VKDKDKQDSFELDLEDAIQPPPISISAPDLAFLEFTNLHTTFPLRRSVSSTELLYERAMARFYEA 812
            .....:.....:.:::.|.||.|.                   |.|.:..|   |.|.:.   ||
 Frog  1175 GPSDPRLHPQPILVKEVIVPPKIR-------------------LPRHLKQT---YIRKVG---EA 1214

  Fly   813 VELE---QASKSRKTSRDKLVTPVPHQTPANLRKRLGSISEAERLSFERRSEMRRQSADVVSISR 874
            |.|.   |.....|.|..|..:.| .:|..::|.     ||.:.:.|.|::|.        |.|.
 Frog  1215 VNLVIPFQGKPRPKVSWKKNGSHV-DKTQISIRN-----SECDTILFIRKAER--------SHSG 1265

  Fly   875 KWDSR---ENVNEMGNL 888
            |:|.:   ||:.:..::
 Frog  1266 KYDLKVKVENLQDKASI 1282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020 22/134 (16%)
I-set 138..227 CDD:254352 21/92 (23%)
Ig 155..224 CDD:143165 18/72 (25%)
IG_like 243..323 CDD:214653 27/81 (33%)
Ig 250..323 CDD:299845 25/73 (34%)
FN3 327..411 CDD:238020 27/85 (32%)
mybpc1XP_031754721.1 Ig 173..273 CDD:416386
Ig strand A 174..177 CDD:409353
Ig strand A' 180..183 CDD:409353
Ig strand B 188..195 CDD:409353
Ig strand C 204..209 CDD:409353
Ig strand C' 214..216 CDD:409353
Ig strand D 224..232 CDD:409353
Ig strand E 239..243 CDD:409353
Ig strand F 253..260 CDD:409353
Ig strand G 264..273 CDD:409353
THB 322..355 CDD:408162
Ig 369..450 CDD:416386 9/59 (15%)
Ig strand A 369..371 CDD:409353
Ig strand A' 374..378 CDD:409353
Ig strand B 382..388 CDD:409353
Ig strand C 395..400 CDD:409353 2/8 (25%)
Ig strand C' 403..406 CDD:409353 0/2 (0%)
Ig strand D 411..416 CDD:409353 2/4 (50%)
Ig strand E 419..424 CDD:409353 0/4 (0%)
Ig strand F 433..439 CDD:409353 0/5 (0%)
Ig strand G 442..450 CDD:409353 0/7 (0%)
Ig 449..541 CDD:416386 14/91 (15%)
Ig strand A' 464..467 CDD:409353 0/2 (0%)
Ig strand B 471..477 CDD:409353 1/5 (20%)
Ig strand C 484..489 CDD:409353 1/4 (25%)
Ig strand C' 492..497 CDD:409353 0/4 (0%)
Ig strand D 502..507 CDD:409353 1/4 (25%)
Ig strand E 510..515 CDD:409353 0/4 (0%)
Ig strand F 524..531 CDD:409353 1/6 (17%)
Ig strand A 545..548 CDD:409353 0/2 (0%)
Ig 547..617 CDD:416386 18/71 (25%)
Ig strand A' 551..555 CDD:409353 1/3 (33%)
Ig strand B 563..571 CDD:409353 2/7 (29%)
Ig strand C' 582..584 CDD:409353 0/1 (0%)
Ig strand D 590..595 CDD:409353 2/4 (50%)
Ig strand E 598..603 CDD:409353 1/4 (25%)
Ig_C5_MyBP-C 646..730 CDD:409475 28/83 (34%)
Ig strand B 657..661 CDD:409475 3/3 (100%)
Ig strand C 670..674 CDD:409475 1/3 (33%)
Ig strand E 696..700 CDD:409475 2/3 (67%)
Ig strand F 710..715 CDD:409475 1/4 (25%)
Ig strand G 723..726 CDD:409475 0/2 (0%)
FN3 742..823 CDD:238020 25/80 (31%)
FN3 833..>895 CDD:238020 14/87 (16%)
Myb_DNA-bind_5 881..957 CDD:404714 13/87 (15%)
GT1 1014..1090 CDD:419993 18/83 (22%)
FN3 <1134..1179 CDD:238020 11/54 (20%)
Ig 1206..1286 CDD:416386 25/97 (26%)
Ig strand A 1206..1210 CDD:409353 2/6 (33%)
Ig strand B 1215..1221 CDD:409353 2/5 (40%)
Ig strand C 1227..1233 CDD:409353 2/5 (40%)
Ig strand D 1244..1249 CDD:409353 1/9 (11%)
Ig strand E 1250..1256 CDD:409353 0/5 (0%)
Ig strand F 1265..1273 CDD:409353 2/7 (29%)
Ig strand G 1276..1286 CDD:409353 0/7 (0%)
FN3 1290..1379 CDD:238020
I-set 1405..1494 CDD:400151
Ig strand B 1422..1426 CDD:409353
Ig strand C 1435..1439 CDD:409353
Ig strand E 1460..1464 CDD:409353
Ig strand F 1474..1479 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000709
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X825
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.