DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MnM and igfn1.3

DIOPT Version :10

Sequence 1:NP_647779.2 Gene:MnM / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:XP_005168832.1 Gene:igfn1.3 / 100331959 ZFINID:ZDB-GENE-131122-44 Length:1355 Species:Danio rerio


Alignment Length:957 Identity:201/957 - (21%)
Similarity:303/957 - (31%) Gaps:347/957 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PQGGRPKKNVHWKSAERPSPPGR-------PILTPVALPEQQPDVVNLRWDRPLHDGGSPITGY- 68
            |:..:||        .:|.|..:       ||..|.|.|:.:|:|   |.::|..:..:|.... 
Zfish   486 PEPHKPK--------PKPQPQPQIKQESEGPIEEPEAEPKPEPEV---REEKPKTEEAAPPQAEE 539

  Fly    69 --TVEHRRMGSPHWVRATPTPVDRCDVCISGLEPGWRYQFRCFAENIVGRSDASELSDPLTVTLQ 131
              |.|..|..    ||..|...|      :.::||                              
Zfish   540 EPTKEEPRKR----VRTGPLVPD------TVIDPG------------------------------ 564

  Fly   132 RNAITVPRFIDELVDTNAVEDERIEFRVRILGEPPPEINWFKDGYEIFSSRRTKIVNDNEASVLV 196
                  ..|...|.|.:|:..:..|...::..|....| |:|||.||.::...|||.|.....:|
Zfish   565 ------VHFTSGLSDVHAIIGQTAEMVCKLSSENCDGI-WYKDGIEITATDDLKIVKDGAVHKIV 622

  Fly   197 IHQVALTDEGEIKCTATNRAGHVITKARLMVQAPPKIRLP--RTYEDGLIVEADEVLRLKVGVAG 259
            :......|.|:.:..|..|.    |:|.|:|:.||:|.|.  ..:.:.:|::..:....|:...|
Zfish   623 VSNCTEDDNGKYRFEADGRK----TEAILVVEDPPRINLEDLAKFSEPVIIKVGQNATFKLEFVG 683

  Fly   260 QPPPAITWLHEGEVIAPGGRFEVSNTEKNSLLKIDNVLREDRGEYMVKAWNRLGE-DSTSFLVTV 323
            :.|..|.|..|||.:......::..:..:|.|.:....|:|.||..:|..|..|. ::.|.|:.:
Zfish   684 REPMKIQWYQEGEEMLEDNHIKIERSSIHSRLLLVKCQRKDSGEIKLKLKNEFGTIEARSKLIVI 748

  Fly   324 TARPNPPGTPKLNMSFGKSATLSWTAPLDDGGCKIGNYIVEYFRVGWNVWLKAAT---------- 378
            ....||.|...:..:........|..|.||||..|.||.:|..::|.|.|:|...          
Zfish   749 DKPTNPMGPVDVIEASSSCVEFKWRPPKDDGGSPIINYYLERNQIGRNTWMKIGNIPGEPHYKDN 813

  Fly   379 -----------TRALST------------------------------------------------ 384
                       .|||:.                                                
Zfish   814 DVDHGRKYCYRIRALTAEGTSDVYETSDIQAGTKAYPGQPSTPKVVSAFKNCITLAWTPPTNTGG 878

  Fly   385 ---------------------------------TLHDLIEGSEYKFRVKAENPYGLSEPSGESEL 416
                                             .:.|::||.||:|||.|.|..|..|||..||.
Zfish   879 TNIVGYNMEKRKRGSNLWGQVNPPEEPIKGKQYDVKDVVEGMEYEFRVSAINFSGAGEPSAPSEF 943

  Fly   417 LFIPDPKRGITKPKSATRIAGDEKDKPKTGAGGMQVPPRRKTLSPPRPQADASTGMSPKQSPSAK 481
            :...|||:                                    ||....|.....|...|.|..
Zfish   944 VIARDPKK------------------------------------PPGKVIDLKVTDSTYSSLSLS 972

  Fly   482 -RKPKPQLIDNEQLTHEMSYGTSDHALKMDVRKSPSLNSADSANKPTTDSSNPKLNLTLVTTTLA 545
             .|||.:            .|..|.|....|...|: .|.|...    .:|||     |:|.:..
Zfish   973 WTKPKEE------------KGVQDEAKGYFVELRPA-ESIDWGR----CNSNP-----LITASYT 1015

  Fly   546 PLDKSVPSPKAPRTPATSPLKLFNPKPSGAPKDRS--------PVQP-----KPQPLPTPPMETP 597
            .|.....:....|..||      |....|.|||..        ||:|     |.:.......|..
Zfish  1016 ILGLKSMAMYWVRVVAT------NEGGDGEPKDLDNYIIAMPPPVRPNFTNRKMKSFMVVRAENS 1074

  Fly   598 DKASPNPKRSLSPPNKRQPPPLRKSPTPPEPIKVTPALLRSAEPVQLGVNQNVRRFSGQTLSPAR 662
            .:.:.|               ...||||      |...|:...||...||          :|.|.
Zfish  1075 ARVNIN---------------FEASPTP------TIIWLKDGMPVSKRVN----------ISNAD 1108

  Fly   663 NVPTLALAVA----SGVSAV-----IGEKLPTIEISAPPTPQEEEPPVLER------SPSPEPAP 712
            .:..|.:|.|    ||:.::     :|::..::||.....|:...|..||.      :.|.||:.
Zfish  1109 GMSQLLIASAERSDSGIYSITVKNMVGQETFSVEIRVTDDPKPPGPVELEENVPGTLTVSWEPSS 1173

  Fly   713 -------------KSQSNARRFSRSADK-------HDDVHTSNEFMLVVFDKN----SKVKDK-- 751
                         |..|..|.:...||:       ..::....|:...|:.||    |:..:.  
Zfish  1174 DEKRDNHLHYMVMKRDSVKRTWQTVADRLFNNNFTAVNITPGREYKFRVYAKNDIGLSEPSESLK 1238

  Fly   752 ----DKQDSFELDLEDAIQPP--PISI-SAPDLAFLEFT---NLHTT 788
                .|::.|.|:|     ||  |.:. |||:     ||   .:|||
Zfish  1239 WGVVKKREKFILNL-----PPSKPCNFDSAPN-----FTVPLKMHTT 1275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MnMNP_647779.2 FN3 29..127 CDD:238020 21/107 (20%)
I-set 138..227 CDD:400151 25/88 (28%)
Ig strand B 155..159 CDD:409565 1/3 (33%)
Ig strand C 168..172 CDD:409565 1/3 (33%)
Ig strand E 194..197 CDD:409565 0/2 (0%)
Ig strand F 207..212 CDD:409565 0/4 (0%)
Ig strand G 220..223 CDD:409565 1/2 (50%)
Ig 243..323 CDD:472250 20/80 (25%)
Ig strand B 251..255 CDD:409353 0/3 (0%)
Ig strand C 264..268 CDD:409353 1/3 (33%)
Ig strand E 289..293 CDD:409353 2/3 (67%)
Ig strand F 303..308 CDD:409353 1/4 (25%)
Ig strand G 316..319 CDD:409353 0/2 (0%)
FN3 327..411 CDD:238020 32/185 (17%)
PHA03247 <420..718 CDD:223021 68/339 (20%)
igfn1.3XP_005168832.1 I-set 44..135 CDD:400151
Ig strand B 61..65 CDD:409405
Ig strand C 74..78 CDD:409405
Ig strand E 101..105 CDD:409405
Ig strand F 115..120 CDD:409405
Ig strand G 128..131 CDD:409405
THB 185..215 CDD:465725
Ig 326..410 CDD:472250
Ig strand B 341..345 CDD:409543
Ig strand C 353..357 CDD:409543
Ig strand E 380..384 CDD:409543
Ig strand F 394..399 CDD:409543
Ig strand G 403..406 CDD:409543
Ig 566..638 CDD:472250 20/72 (28%)
Ig strand B 582..586 CDD:409559 1/3 (33%)
Ig strand C 594..598 CDD:409559 1/4 (25%)
Ig strand E 619..623 CDD:409559 0/3 (0%)
Ig strand F 633..638 CDD:409559 0/4 (0%)
Ig strand G 642..645 CDD:409559 1/6 (17%)
Ig 662..747 CDD:472250 20/84 (24%)
Ig strand B 675..679 CDD:409406 0/3 (0%)
Ig strand C 688..692 CDD:409406 1/3 (33%)
Ig strand E 713..717 CDD:409406 2/3 (67%)
Ig strand F 727..732 CDD:409406 1/4 (25%)
Ig strand G 740..743 CDD:409406 0/2 (0%)
FN3 751..834 CDD:214495 20/82 (24%)
FN3 <810..1169 CDD:442628 82/453 (18%)
FN3 1149..1236 CDD:238020 17/86 (20%)
I-set 1264..1353 CDD:400151 6/17 (35%)
Ig strand B 1281..1285 CDD:409543
Ig strand C 1294..1298 CDD:409543
Ig strand E 1319..1323 CDD:409543
Ig strand F 1333..1338 CDD:409543
Ig strand G 1346..1349 CDD:409543
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.