DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14963 and CG13905

DIOPT Version :9

Sequence 1:NP_647778.1 Gene:CG14963 / 38383 FlyBaseID:FBgn0035409 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_612072.2 Gene:CG13905 / 38107 FlyBaseID:FBgn0035176 Length:238 Species:Drosophila melanogaster


Alignment Length:230 Identity:81/230 - (35%)
Similarity:123/230 - (53%) Gaps:18/230 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDWLLLITLASGSLALWSPQLVPPTVGLLAP-GPPATLAPPPTLSQDLEEIQRLIQSKPLNQLLV 68
            |.::.|:...|.:.|:.:|         :.| |...|||.....:.:|:.:.|.|....:.:|:.
  Fly     9 LGFMCLVAFPSATPAILAP---------IRPYGQNGTLAQQNNFALELKSVIRQIPVDNIEKLVQ 64

  Fly    69 RYLINDAQFQAFVRIINSNAAVTARWRLLSQPELILFLQWTDQQLLASGGS---FELEEQRLKVS 130
            .||:||.:||..:|.|||..|.....:|::|||:....||..|||:.|||.   |:..|  |::.
  Fly    65 TYLLNDIEFQGVIRAINSLPAYRFYRQLINQPEVRQLQQWITQQLILSGGGPKIFDYLE--LEIK 127

  Fly   131 LLNQFPYWSGTVFGWQGFLNE-VQLYFPLYAIRAHIDAKVLQQG-IFAQFWSRLQGLRVMYERWL 193
            :||::||||..|.|.|||..| ||:| |:..||:.::....|.. ..::.|.||..||.:|||.|
  Fly   128 ILNKYPYWSQIVNGIQGFQAEFVQIY-PVQLIRSFLEPSATQTSPQLSELWRRLVALRPVYERVL 191

  Fly   194 TTVETTQVLAELQKAGIDTVQLDGIIRELLGWNAV 228
            .|.....:.||||:.|:|...:|.:||...||:.|
  Fly   192 ATPPGKAITAELQRLGVDVGGVDALIRYQFGWSNV 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14963NP_647778.1 Ins_allergen_rp 49..216 CDD:284230 65/171 (38%)
CG13905NP_612072.2 Ins_allergen_rp 42..214 CDD:284230 65/174 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462464
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F7W0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I7681
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019894
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21163
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.