powered by:
Protein Alignment CG14963 and CG3906
DIOPT Version :9
Sequence 1: | NP_647778.1 |
Gene: | CG14963 / 38383 |
FlyBaseID: | FBgn0035409 |
Length: | 261 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611802.1 |
Gene: | CG3906 / 37721 |
FlyBaseID: | FBgn0034871 |
Length: | 240 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 21/71 - (29%) |
Similarity: | 31/71 - (43%) |
Gaps: | 15/71 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 161 IRAHIDAKVLQQGIFAQFWSRLQGLRVM-------YERWLTTVETTQ------VLAELQKAGIDT 212
|||.|:.:.|...|...:...|:..|.| :|| ||.:.|. ||.|||...:||
Fly 65 IRAMINQEALLNLIEVHYNCDLKFRRAMRYYNTAGFER--TTQQLTDTDAYKTVLKELQSESVDT 127
Fly 213 VQLDGI 218
..::.:
Fly 128 ADIETV 133
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45462474 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR21163 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.