DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14963 and CG9021

DIOPT Version :9

Sequence 1:NP_647778.1 Gene:CG14963 / 38383 FlyBaseID:FBgn0035409 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001285647.1 Gene:CG9021 / 33818 FlyBaseID:FBgn0031747 Length:316 Species:Drosophila melanogaster


Alignment Length:273 Identity:55/273 - (20%)
Similarity:99/273 - (36%) Gaps:93/273 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LALWSPQ--------LVPPTVGLLAPGPPAT--------LAP------PPTLSQDLEEIQR---- 56
            |.:|..|        :....||..|....:|        |.|      |....:.|..:.|    
  Fly    66 LPVWEEQEHVRFAREVTEKPVGTAATAENSTPKDTLDLVLQPKENKECPTNAERGLTNLVRVARP 130

  Fly    57 LIQSKPLNQLLVRYLINDAQFQAFVRIINSNAAVTARWRLLSQPELILFLQWTDQ-QLLASGGSF 120
            |:.:..|..:|... :.|.|.|..::::.|:...|.          :..|:.|.| |||     .
  Fly   131 LLPAATLKNILANG-VEDPQVQELIKLLRSDNFKTQ----------VQLLKATKQHQLL-----H 179

  Fly   121 ELEEQRLK-----------------------VSLLNQFPYWSGTVFGWQGFLNEVQ--------- 153
            :...:|||                       :.|.|:.|       |.:|.|.:::         
  Fly   180 DYVCRRLKLDPTYYAEYVRVFLDLHISDPPTIKLPNRRP-------GVRGLLQDLREALPRTALR 237

  Fly   154 -LYFPLYAIRAHIDAKV-LQQGIFAQFWSRLQGLRVMYERWLTTVETTQVLAELQKAGIDTVQLD 216
             :|..||:..:.:.:.: |.:|  ::|...|:.||.:       .|...:.|:|:|:|:...||.
  Fly   238 NMYQQLYSSDSELSSAIRLIRG--SEFRRLLRDLRQL-------KEYRSLAADLEKSGVPLRQLQ 293

  Fly   217 GIIRELLGWNAVN 229
            .::...|||:.|:
  Fly   294 QLVANALGWSTVD 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14963NP_647778.1 Ins_allergen_rp 49..216 CDD:284230 40/205 (20%)
CG9021NP_001285647.1 Ins_allergen_rp 120..293 CDD:284230 40/204 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21163
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.