DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32278 and TRM5

DIOPT Version :10

Sequence 1:NP_728822.1 Gene:CG32278 / 38382 FlyBaseID:FBgn0052278 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_011937.1 Gene:TRM5 / 856467 SGDID:S000001112 Length:499 Species:Saccharomyces cerevisiae


Alignment Length:71 Identity:18/71 - (25%)
Similarity:26/71 - (36%) Gaps:20/71 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AAKPKSALNKSKKAKNVFKVGDGN-----KG-------------KGKKPKEVQGKLKQIKESVKA 61
            ::|||..|...:..|  .|..|||     ||             .||.|::....||:....:..
Yeast    84 SSKPKDELTSVQNKK--LKTADGNNTPVTKGVLLHESIHSVEDAYGKLPEDALAFLKENSAEIVP 146

  Fly    62 KQEKLD 67
            .:..||
Yeast   147 HEYVLD 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32278NP_728822.1 None
TRM5NP_011937.1 Met_10 176..436 CDD:396850
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.