DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32278 and trm5

DIOPT Version :10

Sequence 1:NP_728822.1 Gene:CG32278 / 38382 FlyBaseID:FBgn0052278 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001018269.3 Gene:trm5 / 3361429 PomBaseID:SPAPB18E9.01 Length:440 Species:Schizosaccharomyces pombe


Alignment Length:61 Identity:16/61 - (26%)
Similarity:26/61 - (42%) Gaps:4/61 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KEVQGKLKQIK----ESVKAKQEKLDASLKTLHKDLVVKKPKAPVAPIKSYKKKGVDAQKV 102
            |.:.||:...|    |:|..|.:.:|...:|...:::..|....|...:|..|...|..||
pombe   151 KYIIGKVILDKNPSIETVVNKTDTIDTKFRTFQMEVLAGKDDFIVTQSESNCKFRFDFSKV 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32278NP_728822.1 None
trm5NP_001018269.3 Met_10 131..380 CDD:396850 16/61 (26%)

Return to query results.
Submit another query.