DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asciz and IDD2

DIOPT Version :9

Sequence 1:NP_001261357.1 Gene:Asciz / 38381 FlyBaseID:FBgn0035407 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_190639.1 Gene:IDD2 / 824234 AraportID:AT3G50700 Length:452 Species:Arabidopsis thaliana


Alignment Length:296 Identity:65/296 - (21%)
Similarity:113/296 - (38%) Gaps:66/296 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RELMPVREHRCERCPSLVFGNLSHYQLH---------LRRRHQEVIPPSVIGPIVAFHCPVEKCI 66
            :.|:......||.| :..|....:.|||         ||::..:.:...|      :.||...|:
plant    55 KTLLATNRFVCEIC-NKGFQRDQNLQLHRRGHNLPWKLRQKSNKEVKKKV------YVCPEVSCV 112

  Fly    67 YHVATKGARSFTSLRLLRQHYQKSHLDKNYKCLACGGKFLLQHHLEKHQ--C--SKHKCPVCELT 127
            :|   ..:|:...|..:::|:.:.|.:|.:||..|..|:.:|...:.|.  |  .::||. |...
plant   113 HH---DPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQSDWKAHSKICGTKEYKCD-CGTL 173

  Fly   128 YNSKAGLRTH------MRRKNHLVHHESDKVPIPSLATWKRLNPQPIPVSADSLTAHSLKTGSDL 186
            ::.:....||      :..:|...||...|...|.:.|.|...|.|:|...|:.:| .:|:.|.|
plant   174 FSRRDSFITHRAFCDALAEENARSHHSQSKKQNPEILTRKNPVPNPVPAPVDTESA-KIKSSSTL 237

  Fly   187 -----------------HPSEEYINNLPSN--LAGVTELYAEIPNPEANMPSTLEL--------D 224
                             .|....:|.:.||  .||:.|..:..|:......|:..|        .
plant   238 TIKQSESPKTPPEIVQEAPKPTSLNVVTSNGVFAGLFESSSASPSIYTTSSSSKSLFASSSSIEP 302

  Fly   225 TNLPAAEEHILCFL--------PIMDVSYALEMSSQ 252
            .:|..:..|...||        |.|..:..|:.::|
plant   303 ISLGLSTSHGSSFLGSNRFHAQPAMSATALLQKAAQ 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AscizNP_001261357.1 C2H2 Zn finger 98..117 CDD:275368 6/22 (27%)
zf-C2H2_2 <116..>143 CDD:289522 6/34 (18%)
C2H2 Zn finger 121..139 CDD:275368 4/23 (17%)
IDD2NP_190639.1 C2H2 Zn finger 65..85 CDD:275368 7/20 (35%)
C2H2 Zn finger 106..134 CDD:275368 7/30 (23%)
C2H2 Zn finger 141..160 CDD:275368 5/18 (28%)
C2H2 Zn finger 168..184 CDD:275368 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.