DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asciz and CG14451

DIOPT Version :9

Sequence 1:NP_001261357.1 Gene:Asciz / 38381 FlyBaseID:FBgn0035407 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_649410.1 Gene:CG14451 / 40488 FlyBaseID:FBgn0037183 Length:264 Species:Drosophila melanogaster


Alignment Length:152 Identity:39/152 - (25%)
Similarity:63/152 - (41%) Gaps:32/152 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 CERCPSLVFGNLSHYQLHLRRRHQEVIPPSVIGPIVAFHCPVEKCIYHVATKGARSFTSLRLLRQ 85
            ||.| ..|:.:|..|..|:...|:..:|...:  :..||||...|.:|....|.::|..:..||:
  Fly    22 CEWC-GKVYKSLVRYHNHIVCTHKLPVPDHQL--VNCFHCPRSDCRFHKHGPGVQNFRQIGRLRR 83

  Fly    86 HYQKSHLDKNYKCLACGGKFLLQHHLEKHQC----------------SKHKCPVCELTYNSKAGL 134
            |||:.|:..:..|..|..:|.|:..|..|:|                .:|   ||:..|      
  Fly    84 HYQEKHMTGHLTCEYCQKQFQLKSALVAHRCRLRHPAIRDSQSAITLGRH---VCKKGY------ 139

  Fly   135 RTH---MRRKNHLVHHESDKVP 153
             ||   ::|:.....|.:...|
  Fly   140 -THLGALQRRLTCCQHGTPNTP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AscizNP_001261357.1 C2H2 Zn finger 98..117 CDD:275368 7/34 (21%)
zf-C2H2_2 <116..>143 CDD:289522 8/45 (18%)
C2H2 Zn finger 121..139 CDD:275368 5/20 (25%)
CG14451NP_649410.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D382234at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.