Sequence 1: | NP_001261357.1 | Gene: | Asciz / 38381 | FlyBaseID: | FBgn0035407 | Length: | 388 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001178599.1 | Gene: | Zbtb41 / 289052 | RGDID: | 1560834 | Length: | 908 | Species: | Rattus norvegicus |
Alignment Length: | 560 | Identity: | 101/560 - (18%) |
---|---|---|---|
Similarity: | 149/560 - (26%) | Gaps: | 267/560 - (47%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MHSEKHTPDIRELMPVREHRCERCPSL-------------------------------------- 27
Fly 28 --VFGNLSHYQLHL-----------------------RRRHQEVIPPSVIGPIVAFHCPV----- 62
Fly 63 -----------------EKCIYHVATKGARSFTSLR-------------------------LLRQ 85
Fly 86 HYQKSHLDKNYKCLACGGKFLLQHHLEKH-------------QCSK------------------- 118
Fly 119 ----------HKCPVCELTYNSKAGLRTHMRRKN----------------------HLVHHESDK 151
Fly 152 VPIPSL---ATWKRLNPQPIPVSADSLT-----AHSLKTGSD-LHPSEEYINNLPSNLAGVTELY 207
Fly 208 AEIPNPEANMPSTLELDTNLPAAEEHILCFLPIMDVSYALEMSSQKLDMETQTEEDDLNEIRN-- 270
Fly 271 -EVLAPLLRDIETQTPDTRGDIGTMTDDFPEEQEPVAVGSHFHAYSETEPMFDLQTSAHMYTQTC 334
Fly 335 DDLFEELGLSHIQTQTHWPDGLYNTQHTQTCDEIMDELFP 374 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Asciz | NP_001261357.1 | C2H2 Zn finger | 98..117 | CDD:275368 | 8/31 (26%) |
zf-C2H2_2 | <116..>143 | CDD:289522 | 10/77 (13%) | ||
C2H2 Zn finger | 121..139 | CDD:275368 | 6/17 (35%) | ||
Zbtb41 | NP_001178599.1 | BTB | 78..174 | CDD:279045 | |
BTB | 90..174 | CDD:197585 | |||
C2H2 Zn finger | 362..382 | CDD:275368 | |||
C2H2 Zn finger | 390..410 | CDD:275368 | 1/4 (25%) | ||
C2H2 Zn finger | 423..441 | CDD:275368 | 3/17 (18%) | ||
C2H2 Zn finger | 464..484 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 492..509 | CDD:275368 | 1/16 (6%) | ||
C2H2 Zn finger | 519..540 | CDD:275368 | 1/20 (5%) | ||
C2H2 Zn finger | 548..568 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 561..585 | CDD:290200 | 1/23 (4%) | ||
C2H2 Zn finger | 576..596 | CDD:275368 | 2/19 (11%) | ||
zf-C2H2 | 602..624 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 604..624 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 616..641 | CDD:290200 | 6/24 (25%) | ||
C2H2 Zn finger | 632..650 | CDD:275368 | 2/17 (12%) | ||
C2H2 Zn finger | 669..686 | CDD:275368 | 5/16 (31%) | ||
zf-H2C2_2 | 681..704 | CDD:290200 | 3/22 (14%) | ||
C2H2 Zn finger | 697..717 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 725..742 | CDD:275368 | 6/25 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |