| Sequence 1: | NP_523897.2 | Gene: | CG15812 / 38379 | FlyBaseID: | FBgn0035405 | Length: | 518 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001072337.1 | Gene: | klhl24 / 779790 | XenbaseID: | XB-GENE-1000313 | Length: | 600 | Species: | Xenopus tropicalis |
| Alignment Length: | 217 | Identity: | 45/217 - (20%) |
|---|---|---|---|
| Similarity: | 77/217 - (35%) | Gaps: | 52/217 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 9 HSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATIMLPDI 73
Fly 74 RG---DLLECMLSFIYMGETSLPSAS-----------------------LPEFLEAINLLGIK-- 110
Fly 111 ------SAISFECNPSASPPSVDVENHSLAVESAKSITGLQIAEAELLDDEEEPHPMVSVPATTL 169
Fly 170 AGSQHQPSHSSRSLEYIDVYEP 191 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15812 | NP_523897.2 | BTB | 20..113 | CDD:279045 | 26/126 (21%) |
| BTB | 35..118 | CDD:197585 | 24/116 (21%) | ||
| HTH_psq | 348..392 | CDD:283007 | |||
| HTH_psq | 458..501 | CDD:283007 | |||
| klhl24 | NP_001072337.1 | BTB_POZ_KLHL24_KRIP6 | 48..168 | CDD:349562 | 25/122 (20%) |
| PHA03098 | 59..566 | CDD:222983 | 42/206 (20%) | ||
| KELCH repeat | 354..393 | CDD:276965 | |||
| KELCH repeat | 397..441 | CDD:276965 | |||
| KELCH repeat | 444..489 | CDD:276965 | |||
| KELCH repeat | 492..529 | CDD:276965 | |||
| KELCH repeat | 536..578 | CDD:276965 | |||
| Kelch | 545..591 | CDD:128874 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||