DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and ZBTB14

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001137295.1 Gene:ZBTB14 / 7541 HGNCID:12860 Length:449 Species:Homo sapiens


Alignment Length:275 Identity:57/275 - (20%)
Similarity:102/275 - (37%) Gaps:54/275 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 HSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATIMLPDI 73
            |.:..:......|.:.:.|::.:...| |:.|||..||:.||...:.|...:.....:.|.:..:
Human    18 HKTLFLKTLNEQRLEGEFCDIAIVVED-VKFRAHRCVLAACSTYFKKLFKKLEVDSSSVIEIDFL 81

  Fly    74 RGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIKSAISFECNPSASPPSVDVENHSLAVESA 138
            |.|:.|.:|:::|..:.|:....:...:.:..:|||: .:...|:......|.| ||:.    .:
Human    82 RSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIR-FLDKLCSQKRDVSSPD-ENNG----QS 140

  Fly   139 KSITGLQIAE-----AELLDDEEEPHPMVSVPATTLAGSQHQPSHSSRSLEYIDVYE--PPKITY 196
            ||...|:|..     |:..||:.|          .:......||.        |..|  ||    
Human   141 KSKYCLKINRPIGDAADTQDDDVE----------EIGDQDDSPSD--------DTVEGTPP---- 183

  Fly   197 SIEHMDGSSSGNQFILTENTGTFTITQS-ASSLSKIEADETGTSGAEVDLGDDDVDADLAEDS-- 258
              ...||.|.         |.|..:.:: ...|...|..:....|.||:..:.....||...:  
Human   184 --SQEDGKSP---------TTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQ 237

  Fly   259 ----EEHESQMIDEE 269
                .:..|::.||:
Human   238 ALTFNDGMSEVKDEQ 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 22/92 (24%)
BTB 35..118 CDD:197585 20/82 (24%)
HTH_psq 348..392 CDD:283007
HTH_psq 458..501 CDD:283007
ZBTB14NP_001137295.1 BTB_POZ_ZBTB14 18..131 CDD:349513 24/114 (21%)
Nuclear localization signal. /evidence=ECO:0000255 50..66 6/15 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..194 14/73 (19%)
C2H2 Zn finger 279..299 CDD:275368
SFP1 <303..383 CDD:227516
C2H2 Zn finger 307..327 CDD:275368
zf-H2C2_2 319..344 CDD:404364
C2H2 Zn finger 335..355 CDD:275368
C2H2 Zn finger 363..383 CDD:275368
C2H2 Zn finger 391..407 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.