DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and AgaP_AGAP003286

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_001687819.2 Gene:AgaP_AGAP003286 / 5667424 VectorBaseID:AGAP003286 Length:319 Species:Anopheles gambiae


Alignment Length:259 Identity:58/259 - (22%)
Similarity:101/259 - (38%) Gaps:41/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HLKWMGHSSTIMDIQRSL-RNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEA 66
            ||:|..:.:.:.....|. :.||:..::.|.. :|.::|||..:|:.||...:.|...||.....
Mosquito     8 HLRWNNYKAFVTGALDSFHQQDNKMLDITLFC-EGRKIRAHKLLLAACSAYFKELFELVPLQHNH 71

  Fly    67 TIMLPDIRGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIKSAISFECNPSASPPSVDVENH 131
            .|:..:|..|::..::.|:|:||.::|...|.||....:.|.|........:..|:..||...:.
Mosquito    72 MIICSNISHDVMMSLVQFMYLGEVNVPQEHLAEFFRTADKLSIWGLTYDPSDQPAATASVQQTSQ 136

  Fly   132 SLAVESAKSITGLQIAEAELLDDEEEPHPMVSVPATTLAGSQ--------------------HQP 176
            .:||:...:.|..::....|:    |..|::..|..|...:|                    .||
Mosquito   137 CVAVQDQANTTTNKVEPPNLV----EAVPLIQTPLDTNIATQITESRLSTVSTSNQQKEDRSPQP 197

  Fly   177 SHSSRSLEYIDVYEPPKI-TYSIEHMDGSSSGNQFILTENTGTFTITQSASSLSKIEADETGTS 239
            :...:. |:...|.|.|| :||.|             |:.....|..|....:.|.......||
Mosquito   198 ADDGQR-EHTPSYAPVKIESYSSE-------------TDTPNEDTEPQKVVEIRKRRTSRRSTS 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 26/93 (28%)
BTB 35..118 CDD:197585 23/82 (28%)
HTH_psq 348..392 CDD:283007
HTH_psq 458..501 CDD:283007
AgaP_AGAP003286XP_001687819.2 BTB 31..118 CDD:279045 24/87 (28%)
BTB 34..118 CDD:197585 24/84 (29%)
C2H2 Zn finger 264..287 CDD:275370
C2H2 Zn finger 294..315 CDD:275370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23110
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.