DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and KBTBD4

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001305645.1 Gene:KBTBD4 / 55709 HGNCID:23761 Length:567 Species:Homo sapiens


Alignment Length:244 Identity:53/244 - (21%)
Similarity:90/244 - (36%) Gaps:54/244 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VLASRDGVRVRAHLFVLSTCSELMRNLLV-DVPRGQEATIMLPDIRGDLLECMLSFIYMGETSLP 93
            |..|.:|...:.|..|||..|...|::.. ::.......|:|.|:...:.:.::.:||.|...|.
Human    96 VTISVEGREFQLHRLVLSAQSCFFRSMFTSNLKEAHNRVIVLQDVSESVFQLLVDYIYHGTVKLR 160

  Fly    94 SASLPEFLEAINLLGIKSAISFECNPSASPPSVDVEN----------HS--LAVESAKSITGLQI 146
            :..|.|..|..::..:.|... ||:...: .:|.|.|          ||  ....:||......:
Human   161 AEELQEIYEVSDMYQLTSLFE-ECSRFLA-RTVQVGNCLQVMWLADRHSDPELYTAAKHCAKTHL 223

  Fly   147 AEAELLDDEEE----PHPMVS------VPATTLAGSQHQPSHSSRSLEYIDVYEPPKITYSIEHM 201
            |:   |.:.||    ||.:::      ||.            |....|.|:.:    |.::.|..
Human   224 AQ---LQNTEEFLHLPHRLLTDIISDGVPC------------SQNPTEAIEAW----INFNKEER 269

  Fly   202 DGSSSGNQFILT---ENTGTFTITQSAS-------SLSKIEADETGTSG 240
            :..:...:..|.   ||...:.|.:.:|       ||...|.|....||
Human   270 EAFAESLRTSLKEIGENVHIYLIGKESSRTHSLAVSLHCAEDDSISVSG 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 20/83 (24%)
BTB 35..118 CDD:197585 19/83 (23%)
HTH_psq 348..392 CDD:283007
HTH_psq 458..501 CDD:283007
KBTBD4NP_001305645.1 BTB 88..187 CDD:279045 22/91 (24%)
BTB 95..189 CDD:197585 22/94 (23%)
BACK_like 191..249 CDD:269806 13/60 (22%)
Kelch_2 327..363 CDD:284956
KELCH repeat 328..363 CDD:276965
KELCH repeat 367..414 CDD:276965
mutarot_permut 403..>560 CDD:274642
KELCH repeat 417..463 CDD:276965
KELCH repeat 471..516 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.