DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and KLHL24

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001336342.1 Gene:KLHL24 / 54800 HGNCID:25947 Length:625 Species:Homo sapiens


Alignment Length:183 Identity:43/183 - (23%)
Similarity:69/183 - (37%) Gaps:37/183 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 HSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATIMLPDI 73
            |:..|:.|....|:.....:|::.. :|.....|..|||.||...|.:..:..|  |:..||.:|
Human    48 HAENILQIFNEFRDSRLFTDVIICV-EGKEFPCHRAVLSACSSYFRAMFCNDHR--ESREMLVEI 109

  Fly    74 RG---DLLECMLSFIYMGETSLPSAS-----------------------LPEFLEAINLLGIK-- 110
            .|   :.:||.|.::|.|:..:.:.:                       |.|.|:..|.|||:  
Human   110 NGILAEAMECFLQYVYTGKVKITTENVQYLFETSSLFQISVLRDACAKFLEEQLDPCNCLGIQRF 174

  Fly   111 ------SAISFECNPSASPPSVDVENHSLAVESAKSITGLQIAEAELLDDEEE 157
                  ..:..:|...|.....||..|...:|..|......|...||:..:||
Human   175 ADTHSLKTLFTKCKNFALQTFEDVSQHEEFLELDKDELIDYICSDELVIGKEE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 28/126 (22%)
BTB 35..118 CDD:197585 26/116 (22%)
HTH_psq 348..392 CDD:283007
HTH_psq 458..501 CDD:283007
KLHL24NP_001336342.1 BTB 62..591 CDD:333434 39/169 (23%)
KELCH repeat 354..393 CDD:276965
KELCH repeat 397..466 CDD:276965
KELCH repeat 469..514 CDD:276965
KELCH repeat 517..556 CDD:276965
KELCH repeat 559..604 CDD:276965
Kelch 570..616 CDD:128874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.