DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and rib

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001261085.1 Gene:rib / 44855 FlyBaseID:FBgn0003254 Length:680 Species:Drosophila melanogaster


Alignment Length:444 Identity:86/444 - (19%)
Similarity:164/444 - (36%) Gaps:116/444 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKWMGHSSTIMDIQRSLRNDNQH--CEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEA 66
            |:|..|.:.::.|..:|.....:  |.:|:   |..:.:||..||:..|...:::|.|||: ...
  Fly    20 LRWNNHQTNLVQILHALHEVGSYVDCSLVV---DDEQFQAHRVVLAANSPYFQHILKDVPQ-DHC 80

  Fly    67 TIMLPDIRGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIK----SAISF---ECNPSAS-- 122
            :|:||.::|..:..:|.::|.|||::..:..||.|.....|.:|    :.:.|   ...|::|  
  Fly    81 SIILPGVKGFEIAALLQYMYTGETTVTKSQEPEILRTAKELQVKGLYDNLMKFNHASVTPTSSSG 145

  Fly   123 -----PPSVDVENHSLAVESAKSITGLQIAEAELLDDEEEPHPMVSV---PATTLAGSQHQPSHS 179
                 |.:....|||.:|.|    |...|:.:..:.....|.|....   |     |..|.|...
  Fly   146 AGGAKPQNGSASNHSSSVIS----TSTHISPSAAISSSCSPPPPPQFGYQP-----GYSHYPQQQ 201

  Fly   180 SRSLEYIDVYEPPKI-TYSIEHMDGS---SSGNQFILTENTGTF---TITQSASSLSKIEADETG 237
            ..|...|...|.|.. |.:..|...|   .:|.|:.||.:....   ::.:||:.::.::..:..
  Fly   202 PMSASQIPAGEAPLTPTQATPHSAASGAGEAGGQWPLTPSAAAAMLNSVYESAADMNPLKRKKLS 266

  Fly   238 TSGAEVDLGDDDVDADLAEDSEEHESQMIDEEFAQADPL----------------------MELE 280
            ...:.:..|:.|             :.::....|||:|.                      .:|.
  Fly   267 AISSMLLSGNRD-------------TPILRNVLAQANPADSSQPGPMNANGEKTPTHPHQNTQLP 318

  Fly   281 A--------------GTEMDDDDDVHDQLVDEEIDDKPRKLGGGKTRIRRPISAKAVKRLSDCKP 331
            |              |::...|.:......|...:::..:.||.|...:|               
  Fly   319 AGLGVSGGERNHSFNGSDYGGDKEPLSPYTDRSFEEETGQSGGKKPEWKR--------------- 368

  Fly   332 TRIQQFAALKREVKDDINDALDLAADAVIIEGLSLQKAADRFDISKTVLWRRVR 385
                    .|:..:.|:     :.|...:.||:|..:|:.::.:....|:.:||
  Fly   369 --------YKQYTRADM-----MCAIQAVREGMSALQASRKYGLPSRTLYDKVR 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 27/98 (28%)
BTB 35..118 CDD:197585 25/89 (28%)
HTH_psq 348..392 CDD:283007 8/38 (21%)
HTH_psq 458..501 CDD:283007
ribNP_001261085.1 BTB 33..133 CDD:279045 27/103 (26%)
BTB 44..133 CDD:197585 26/92 (28%)
HTH_psq 373..417 CDD:283007 9/42 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.