DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and lolal

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster


Alignment Length:126 Identity:38/126 - (30%)
Similarity:62/126 - (49%) Gaps:9/126 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKWMGHSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATI 68
            |||....:.::...|.||::....:|.||. :|...:||..|||.||...:.||.:.| .:...|
  Fly    10 LKWNDFQTNMVTSFRHLRDEKSFTDVTLAC-EGQTCKAHKMVLSACSPYFKALLEENP-SKHPII 72

  Fly    69 MLPDIRGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIKSAISFECNPSASPPSVDVE 129
            :|.|:....|:.:|.|:|.||.::....||.||:..:.|.:|..       :.:|.|:..|
  Fly    73 ILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGL-------AETPSSIKRE 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 31/92 (34%)
BTB 35..118 CDD:197585 26/82 (32%)
HTH_psq 348..392 CDD:283007
HTH_psq 458..501 CDD:283007
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 28/84 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.