DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and br

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001162638.2 Gene:br / 44505 FlyBaseID:FBgn0283451 Length:1011 Species:Drosophila melanogaster


Alignment Length:620 Identity:120/620 - (19%)
Similarity:200/620 - (32%) Gaps:182/620 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKWMGHSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATI 68
            |:|..:.|:|.....:||:|....:|.||. :|..::||..|||.||...|.||...| .:...|
  Fly     9 LRWNNYQSSITSAFENLRDDEAFVDVTLAC-EGRSIKAHRVVLSACSPYFRELLKSTP-CKHPVI 71

  Fly    69 MLPDIRGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIK----------------------- 110
            :|.|:....|..::.|||.||.::...||..||:...:|.:.                       
  Fly    72 LLQDVNFMDLHALVEFIYHGEVNVHQKSLQSFLKTAEVLRVSGLTQQQAEDTHSHLAQIQNLANS 136

  Fly   111 --------------------------SAISFECNPSASPPSVDVE------NHSLAVESAKSITG 143
                                      |:..|....:.|||...|.      |:.|....|.....
  Fly   137 GGRTPLNTHTQSLPHPHHGSLHDDGGSSTLFSRQGAGSPPPTAVPSLPSHINNQLLKRMAMMHRS 201

  Fly   144 LQIAEAELLDDEEEPHPMV-------SVPATTLAGSQHQ-------PSHSSRSLEYIDVYEPPKI 194
            ...|.|     ||..|...       |:|.:...||...       |.|:..:    ...:.|..
  Fly   202 SAAAAA-----EETSHAFKRLRGSDNSLPLSGAVGSGSNNNSPDLPPLHARSA----SPQQTPAD 257

  Fly   195 TYSIEHM-----------------------------DGSSSGNQFILTENTGTFTITQSASSLSK 230
            ..:|:|.                             :|:|:||...:::..|:.|    .|.|::
  Fly   258 FSTIKHHNNNNTPPLKEEKRNGPTGNGNSGNGNGNGNGASNGNGISISDKLGSLT----PSPLAR 318

  Fly   231 IEADETGTSGAEVDLGDDDVDADLAEDSEEHESQMIDEEFAQADPLME-----LEAGTEMDDDDD 290
            ..||:..:...::...:::.:|     ::||.:....|..|......:     |.:|.       
  Fly   319 AGADDVKSEPMDMVCSNNNANA-----NDEHSNDSTGEHDANRSSSGDGGKGSLSSGN------- 371

  Fly   291 VHDQLVDEEIDDKPRKLGGGKTRIRRPISAK----AVKRLSDCKP-------TRIQQFAALKREV 344
                  ||||.|...........|..|...|    |.....:..|       |::||...|....
  Fly   372 ------DEEIGDGLASHHAAPQFIMSPAENKMFHAAAFNFPNIDPSALLGLNTQLQQSGDLAVSP 430

  Fly   345 KDDINDALDLAADAVIIEGLSLQKAADRFDISKTVLWRRVRTNPAYMRNNRERPSLQEAYERLKN 409
            :.....:|   ...||:.|.|                ....:|.:...||....:.|:..|:..:
  Fly   431 QGGSTGSL---LSGVIVPGGS----------------GGTPSNSSSNNNNNNSNNQQQKVEQQSS 476

  Fly   410 GHSLKSISSELQIPMSTLHRHKVRLSAQGRLPNFVSCRKRDNTPKDELRDKLAKAVHACLNEGM- 473
            .|.|..     |...||.|.:..:|..:.......||:..|..........|:::     ::|| 
  Fly   477 PHQLLQ-----QQHHSTPHTNSPQLKQEQPKSGGGSCKSSDLHIAAGSERSLSRS-----SQGMP 531

  Fly   474 -SQNHAANLFEIPKSTLWRHLQRRTTSQNKKVKKE 507
             :..|:|.    |..|...|.:.|...:.::.::|
  Fly   532 DAGGHSAT----PSPTAAYHKRERERERERERERE 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 33/141 (23%)
BTB 35..118 CDD:197585 28/131 (21%)
HTH_psq 348..392 CDD:283007 6/43 (14%)
HTH_psq 458..501 CDD:283007 9/44 (20%)
brNP_001162638.2 BTB 22..118 CDD:279045 32/97 (33%)
BTB 33..118 CDD:197585 29/86 (34%)
C2H2 Zn finger 712..729 CDD:275368
C2H2 Zn finger 742..763 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.