DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and CG34376

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_732741.1 Gene:CG34376 / 42638 FlyBaseID:FBgn0085405 Length:681 Species:Drosophila melanogaster


Alignment Length:336 Identity:70/336 - (20%)
Similarity:117/336 - (34%) Gaps:80/336 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKWMGHSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATI 68
            |.|......|....::|.:.....:|.||. ||..:.||..||:.||...:.:....| .:...|
  Fly     7 LCWKNFQDNIASGFQNLYDRGDLVDVTLAC-DGKLLHAHKIVLAICSPYFQEIFTTNP-CKHPII 69

  Fly    69 MLPDIRGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIKS-AISFECNP--------SASPP 124
            :|.|:..:::..:|.|:|.|..::....|..|::...||.||. |.:...:|        |:.||
  Fly    70 ILKDVSFNIMMELLEFMYQGVVNVKHTELQSFMKIGQLLQIKGLATNSNSSPGSSVSEKSSSQPP 134

  Fly   125 SVDVEN------HSLAVES---AKSITGLQIAEAELLDDEEEP--HPMVSVPATTLAGSQHQPSH 178
            :.:..|      |:.:..|   :||.|....::.:.......|  ....|..|:.|..|..:|..
  Fly   135 AEESSNTNSTNHHNSSTNSNNNSKSETDHNESKGQSNSRTTSPGGASRASNDASHLYTSNKRPMP 199

  Fly   179 SSRSLEYIDVYEPPKITYSI-EHMDGSSSGNQFILTENTGTFTITQSASSLSKIEADETGTSGAE 242
            |....:.:.:|...::..|: :|..|.|.|.                                  
  Fly   200 SDFGSDSLSIYSGKQLRRSLKDHGSGGSEGG---------------------------------- 230

  Fly   243 VDLGDDDVDADLAEDSEEHESQMIDEEFAQADPLMELEAGTEMDD------DDDVHDQLVDEEID 301
               |.|..|.....|     :.|..|||. ..|:.::..|.:..|      :.|.|..       
  Fly   231 ---GGDHADTAAGLD-----NSMNSEEFF-LPPIPQITMGEQRYDLGGLKRESDGHHH------- 279

  Fly   302 DKPRKLGGGKT 312
             .|...|||.:
  Fly   280 -GPLSAGGGNS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 26/93 (28%)
BTB 35..118 CDD:197585 23/83 (28%)
HTH_psq 348..392 CDD:283007
HTH_psq 458..501 CDD:283007
CG34376NP_732741.1 BTB 20..113 CDD:279045 26/94 (28%)
BTB 31..115 CDD:197585 25/85 (29%)
FLYWCH 390..443 CDD:282369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.