DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and fru

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001163648.1 Gene:fru / 42226 FlyBaseID:FBgn0004652 Length:960 Species:Drosophila melanogaster


Alignment Length:505 Identity:91/505 - (18%)
Similarity:165/505 - (32%) Gaps:154/505 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKWMGHSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATI 68
            |:|..|.:.:..:..||......|:|.||. :|..|:||..:||.||.....:.:. .:.....|
  Fly   113 LRWNNHPTNLTGVLTSLLQREALCDVTLAC-EGETVKAHQTILSACSPYFETIFLQ-NQHPHPII 175

  Fly    69 MLPDIRGDLLECMLSFIYMGETSLPSASLPEFL---EAINLLGI-------------KSAISFEC 117
            .|.|:|...:..:|.|:|.||.::..:|||.||   |::.:.|:             |...|...
  Fly   176 YLKDVRYSEMRSLLDFMYKGEVNVGQSSLPMFLKTAESLQVRGLTDNNNLNYRSDCDKLRDSAAS 240

  Fly   118 NPSASPPS-----------------------------------VDVENHSLAVESAKSITGLQIA 147
            :|:...||                                   ....:.|::..|:.:......|
  Fly   241 SPTGRGPSNYTGGLGGAGGVADAMRESRDSLRSRCERDLRDELTQRSSSSMSERSSAAAAAAAAA 305

  Fly   148 EAELLDDEEEPHPMVSVPATTLAGSQHQPSHSSRS------------------------------ 182
            .|............|::..||..|.:..||..|.|                              
  Fly   306 AAVAAAGGNVNAAAVALGLTTPTGGERSPSVGSASAAAAAAAVAAAVAAAANRSASADGCSDRGS 370

  Fly   183 ----LEYIDVYEP-PKITYSIE---HMDGSSSGNQFILTENTGTFTITQSASSLSKIEADETGTS 239
                ||..|..:. .::.||.:   :.:.||:|.......|....:.:.:.:|.|..|.:.:|..
  Fly   371 ERGTLERTDSRDDLLQLDYSNKDNNNSNSSSTGGNNNNNNNNNNNSSSNNNNSSSNRERNNSGER 435

  Fly   240 GAEVDL-GDDDVDADLAED-----------------------SEEHESQMIDEEFAQAD----PL 276
            ..|.:. .:.|.|.:|:..                       |..|:.:...:: :||:    |:
  Fly   436 ERERERERERDRDRELSTTPVEQLSSSKRRRKNSSSNCDNSLSSSHQDRHYPQD-SQANFKSSPV 499

  Fly   277 MELEAGT-EMDDDDDVHDQ------------------------------LVDEEIDDKPRKLGGG 310
            .:....| |.:|....||.                              .:.:|:.|..::....
  Fly   500 PKTGGSTSESEDAGGRHDSPLSMTTSVHLGGGGGNVGAASALSGLSQSLSIKQELMDAQQQQQHR 564

  Fly   311 KTRIRRP---ISAKAVKRLSDCKPTRIQQFAALKREVKDDINDALDLAAD 357
            :..:..|   :.:.|:|..::...|.:.|.|....:.:|:.|||..|..|
  Fly   565 EHHVALPPDYLPSAALKLHAEDMSTLLTQHALQAADARDEHNDAKQLQLD 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 30/108 (28%)
BTB 35..118 CDD:197585 26/98 (27%)
HTH_psq 348..392 CDD:283007 5/10 (50%)
HTH_psq 458..501 CDD:283007
fruNP_001163648.1 BTB 126..221 CDD:279045 30/96 (31%)
BTB 137..221 CDD:197585 27/85 (32%)
C2H2 Zn finger 901..918 CDD:275368
C2H2 Zn finger 925..944 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.