DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and KLHL31

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001003760.2 Gene:KLHL31 / 401265 HGNCID:21353 Length:634 Species:Homo sapiens


Alignment Length:401 Identity:81/401 - (20%)
Similarity:135/401 - (33%) Gaps:141/401 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LRNDNQHCEVVLASRDGVRVRA---HLFVLSTCSELMRNLLVDVPRGQEATIMLPDIRGDLLECM 81
            :|.:|..|::|:    |.:.::   |..|:::|||...|:|...|..|.  :.|.||....|..:
Human    66 MRQENFLCDLVI----GTKTKSFDVHKSVMASCSEYFYNILKKDPSIQR--VDLNDISPLGLATV 124

  Fly    82 LSFIYMGETSLPSASLPEFLEAINLLGIKSAISFECNPSASPPSVDVENHSLAVESAKSITGLQI 146
            :::.|.|:.:|...::...:.|...|.|.:.:.. |:        |.....::||:...:  :.|
Human   125 IAYAYTGKLTLSLYTIGSIISAAVYLQIHTLVKM-CS--------DFLIREMSVENCMYV--VNI 178

  Fly   147 AEAELLDDEEEPHPMVSVPATTLAGSQHQPSHSSRSLEYIDVYEPPKITYSIEHMDGSSSGNQFI 211
            ||                                              |||:::   :.:..|..
Human   179 AE----------------------------------------------TYSLKN---AKAAAQKF 194

  Fly   212 LTENTGTFTITQSASSLSKIEADETGTSGAEVDLGDDDVDADLAEDSEEHESQMIDEEFAQ---- 272
            :.:|...|..:.....|:..:.:|.        |.|||:  .|..:....:..|...||.|    
Human   195 IRDNFLEFAESDQFMKLTFEQINEL--------LIDDDL--QLPSEIVAFQIAMKWLEFDQKRVK 249

  Fly   273 --ADPLMELEAGT--------------EMDDDDDVHDQLVD----EEIDDKPRKLGGGKTRIR-- 315
              ||.|..:..||              .|..|.|.|..|||    ..:......|...:||||  
Human   250 YAADLLSNIRFGTISAQDLVNYVQSVPRMMQDADCHRLLVDAMNYHLLPYHQNTLQSRRTRIRGG 314

  Fly   316 ---------RP-ISAKAVKR-------------LSDCKPTRIQQFAALKREVKD---------DI 348
                     || ::.|::.|             |::.......|..|    |.|         |.
Human   315 CRVLVTVGGRPGLTEKSLSRDILYRDPENGWSKLTEMPAKSFNQCVA----VMDGFLYVAGGEDQ 375

  Fly   349 NDALDLAADAV 359
            |||.:.|..||
Human   376 NDARNQAKHAV 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 24/95 (25%)
BTB 35..118 CDD:197585 20/85 (24%)
HTH_psq 348..392 CDD:283007 6/12 (50%)
HTH_psq 458..501 CDD:283007
KLHL31NP_001003760.2 BTB 63..164 CDD:279045 26/112 (23%)
PHA03098 73..601 CDD:222983 79/394 (20%)
BACK 172..273 CDD:285009 25/161 (16%)
Kelch 1 317..365 8/51 (16%)
KELCH repeat 356..405 CDD:276965 11/35 (31%)
Kelch 2 366..419 7/21 (33%)
Kelch 367..419 CDD:128874 7/20 (35%)
KELCH repeat 409..453 CDD:276965
Kelch 420..466 CDD:128874
Kelch 3 420..466
Kelch_1 455..500 CDD:279660
KELCH repeat 456..501 CDD:276965
Kelch 4 468..513
Kelch_1 502..552 CDD:279660
KELCH repeat 503..551 CDD:276965
Kelch 5 515..565
KELCH repeat 555..602 CDD:276965
Kelch 6 567..614
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.