DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15812 and klhl7

DIOPT Version :9

Sequence 1:	NP_523897.2	Gene:	CG15812 / 38379	FlyBaseID:	FBgn0035405	Length:	518	Species:	Drosophila melanogaster
Sequence 2:	NP_957171.1	Gene:	klhl7 / 393851	ZFINID:	ZDB-GENE-130212-1	Length:	538	Species:	Danio rerio

Alignment Length:	133	Identity:	36/133 - (27%)
Similarity:	56/133 - (42%)	Gaps:	31/133 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly    11 STIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEAT---IMLPD 72
            |.||.:..:||.....|:|:|.. :|..:.||..|||..|....  |:......||:   :.|..
Zfish    30 SNIMGVMNNLRKQGILCDVILVV-EGKHILAHRVVLSAASHFFS--LMFTSSMMEASNHEVELGG 91

  Fly    73 IRGDLLECMLSFIYMGETSLPSAS-----------------------LPEFLEAINLLGIKSAIS 114
            ...:::|.::.|||....|:.|.:                       |.|.::|.|.||| ||::
Zfish    92 AEPEIIELLVEFIYTARISVNSNNVQSLLNAANQYQIDPVKKMCVDFLKEQVDATNCLGI-SALA 155

  Fly   115 FEC 117
             ||
Zfish   156 -EC 157

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15812	NP_523897.2	BTB	20..113	CDD:279045	30/118 (25%)
		BTB	35..118	CDD:197585	28/109 (26%)
		HTH_psq	348..392	CDD:283007
		HTH_psq	458..501	CDD:283007
klhl7	NP_957171.1	BTB	36..140	CDD:279045	22/106 (21%)
		PHA03098	41..538	CDD:222983	31/122 (25%)
		BACK	148..250	CDD:285009	7/12 (58%)
		KELCH repeat	328..370	CDD:276965
		KELCH repeat	374..418	CDD:276965
		Kelch	385..432	CDD:128874
		KELCH repeat	422..470	CDD:276965
		Kelch	433..482	CDD:128874
		Kelch_1	472..517	CDD:279660
		KELCH repeat	473..517	CDD:276965
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910