DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and bab1

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_728565.1 Gene:bab1 / 38116 FlyBaseID:FBgn0004870 Length:977 Species:Drosophila melanogaster


Alignment Length:210 Identity:46/210 - (21%)
Similarity:84/210 - (40%) Gaps:31/210 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKWMGHSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATI 68
            |:|..:.:.:..|...|..:....:|.||. ||..::||..|||.||...:.||.:.| .|...:
  Fly   104 LRWNNYQTNLTTIFDQLLQNECFVDVTLAC-DGRSMKAHKMVLSACSPYFQTLLAETP-CQHPIV 166

  Fly    69 MLPDIRGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIK---------------SAISFECN 118
            ::.|:....|:.::.|:|.||.::....:...|....:|.::               :|.|.|..
  Fly   167 IMRDVNWSDLKAIVEFMYRGEINVSQDQIGPLLRIAEMLKVRGLADVTHMEAATAAAAAASSERM 231

  Fly   119 PSASPPSVDVE--NHSLAVESAKSITGLQIAEAELLDDEEEPHPMVSVPATTLAG----SQHQPS 177
            ||:...|....  .|....|:.:.:..:| .|.:|...:.:|..:...|.....|    .:..||
  Fly   232 PSSPKESTSTSRTEHDREREAEELLAFMQ-PEKKLRTSDWDPAELRLSPLERQQGRNVRKRRWPS 295

  Fly   178 HSSRSLEYIDVYEPP 192
            ..:       ::.||
  Fly   296 ADT-------IFNPP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 25/107 (23%)
BTB 35..118 CDD:197585 24/97 (25%)
HTH_psq 348..392 CDD:283007
HTH_psq 458..501 CDD:283007
bab1NP_728565.1 BTB 117..216 CDD:279045 25/100 (25%)
BTB 128..213 CDD:197585 24/86 (28%)
HTH_psq 569..614 CDD:283007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.