DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and CG9426

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_609616.1 Gene:CG9426 / 34719 FlyBaseID:FBgn0032485 Length:627 Species:Drosophila melanogaster


Alignment Length:180 Identity:46/180 - (25%)
Similarity:78/180 - (43%) Gaps:50/180 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LRNDNQHCEV-VLASRDGVRVRAHLFVLSTCS---ELMRNLLVDVPRGQEATIMLPDIRGDLLEC 80
            ||..::.|:| ::|..  ..:.||..|||..|   |.|....:.:...::.:::|..|.||:|..
  Fly    76 LREQSRFCDVEIIAGM--ATLSAHRAVLSAASAYFEAMFRPELGLNEVKQKSVVLHTIDGDILHI 138

  Fly    81 MLSFIYMGETSLPSASLPEF-----------------------LEAINLLGI------------- 109
            :|.|||.|...:..:::.|.                       |.|.|.|||             
  Fly   139 LLDFIYTGRCEITQSNVQELLAAADMLQLNEVVDGCCEFLCRELHASNALGILRFAEAHNCESLA 203

  Fly   110 KSAISFECNPSASPPSVDVENHSLAVESAKSITGLQIAEAELL--DDEEE 157
            |||::|   ..|:.|:|.:|:..|  |:.:::.. |:..:|||  |.|.:
  Fly   204 KSALNF---VHANFPAVTLEDEFL--ETPQTLLS-QLLNSELLRVDSESQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 32/132 (24%)
BTB 35..118 CDD:197585 29/121 (24%)
HTH_psq 348..392 CDD:283007
HTH_psq 458..501 CDD:283007
CG9426NP_609616.1 BTB 73..179 CDD:279045 24/104 (23%)
PHA03098 78..558 CDD:222983 44/178 (25%)
BACK 187..289 CDD:285009 19/67 (28%)
Kelch 330..384 CDD:128874
KELCH repeat 374..417 CDD:276965
Kelch 385..431 CDD:128874
KELCH repeat 421..465 CDD:276965
Kelch <447..478 CDD:128874
Kelch_6 467..516 CDD:290672
KELCH repeat 468..512 CDD:276965
Kelch_1 515..557 CDD:279660
KELCH repeat 516..561 CDD:276965
KELCH repeat 564..617 CDD:276965
Kelch 575..627 CDD:128874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.