DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and KLHL17

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_006710663.1 Gene:KLHL17 / 339451 HGNCID:24023 Length:665 Species:Homo sapiens


Alignment Length:418 Identity:80/418 - (19%)
Similarity:149/418 - (35%) Gaps:148/418 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CEVVL--ASRDGVRVRAHLFVLSTCSELMRNLLV-DVPRGQEATIMLPDIRGDLLECMLSFIYMG 88
            |::||  |:::   :|||..||::||.....:.. ::...::..:.|.||....|:.::.|.|..
Human    92 CDIVLHVAAKE---IRAHKVVLASCSPYFHAMFTNEMSESRQTHVTLHDIDPQALDQLVQFAYTA 153

  Fly    89 E---------TSLPSASLPEFLEAINLLGIKSA----ISFECNPSASPPSVDVENHSLAVESAKS 140
            |         |.||:|||      :.|.|::.|    :..:.:||                :...
Human   154 EIVVGEGNVQTLLPAASL------LQLNGVRDACCKFLLSQLDPS----------------NCLG 196

  Fly   141 ITGLQIAEAELLDDEEEPHPMVSVPATTLAGSQHQPSHSSRSLEYIDVYEPPKITYSIEHMDGSS 205
            |.|  .|:|....|              |..:.|:                    |.::|....:
Human   197 IRG--FADAHSCSD--------------LLKAAHR--------------------YVLQHFVDVA 225

  Fly   206 SGNQFILTENTGTFTITQSASSLSKIEADETGTSGAEVDLGDDDVDADLAEDSEEHESQMIDEEF 270
            ...:|:|      ..:.|::|.|       .|::|...||           .||:..||::  |.
Human   226 KTEEFML------LPLKQASSGL-------PGSTGPSPDL-----------RSEDPHSQVL--EL 264

  Fly   271 AQADPLMELEAGTEMDDDDDVHDQL---VDEEIDDKPRKLGGGKTRIRRPISAK----------- 321
            ..:|.|       .:..:::|:..:   |..::|.:.:.:......:|.|:.::           
Human   265 VSSDSL-------NVPSEEEVYRAVLSWVKHDVDARRQHVPRLMKCVRLPLLSRDFLLGHVDAES 322

  Fly   322 AVKRLSDCKPTRIQQFAALKREVKDDINDALDLA---------ADAVI--IEGLSL--------- 366
            .|:...|||...|:   |||..:..:....|..:         |..|:  :.|.||         
Human   323 LVRHHPDCKDLLIE---ALKFHLLPEQRGVLGTSRTRPRRCEGAGPVLFAVGGGSLFAIHGDCEA 384

  Fly   367 -QKAADRFDISKTVLWRRVRTNPAYMRN 393
             ....||:.:..::..||.|...|.:.|
Human   385 YDTRTDRWHVVASMSTRRARVGVAAVGN 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 27/101 (27%)
BTB 35..118 CDD:197585 23/96 (24%)
HTH_psq 348..392 CDD:283007 12/64 (19%)
HTH_psq 458..501 CDD:283007
KLHL17XP_006710663.1 BTB 82..186 CDD:279045 27/102 (26%)
PHA03098 92..581 CDD:222983 80/418 (19%)
BACK 194..318 CDD:285009 30/192 (16%)
Kelch 366..412 CDD:128874 10/45 (22%)
Kelch_1 401..446 CDD:279660 5/12 (42%)
KELCH repeat 402..445 CDD:276965 4/11 (36%)
KELCH repeat 449..492 CDD:276965
Kelch 460..506 CDD:128874
KELCH repeat 496..540 CDD:276965
Kelch 508..553 CDD:128874
KELCH repeat 543..587 CDD:276965
Kelch 555..600 CDD:128874
KELCH repeat 590..635 CDD:276965
Kelch 602..646 CDD:128874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.