DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and CG8924

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_573091.1 Gene:CG8924 / 32557 FlyBaseID:FBgn0030710 Length:514 Species:Drosophila melanogaster


Alignment Length:513 Identity:102/513 - (19%)
Similarity:178/513 - (34%) Gaps:143/513 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKWMGHSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATI 68
            ::|..|..:|......|....:..:|.||. :|.:|..|..||:.||.....:|.:.|......|
  Fly    10 VRWNSHLGSIGAAFPQLLAGQRFVDVTLAC-EGQQVHCHRLVLAACSTYFEAILAEHPCKHPVII 73

  Fly    69 MLPDIRGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIKSAISFECNPSASPPSVDVENHSL 133
            :..:|:...::.::.|:|.||.::..|.|.:.|.....|.|:.....|.                
  Fly    74 LPREIKLWEIQALVDFMYKGEVNVTQAGLGQLLRCAEQLQIRGLYGSEA---------------- 122

  Fly   134 AVESAKSITGLQIAEAELLDDEEEPHPMVSVPATTLAGSQHQPSHSSRSLEYIDVYEPPKITYSI 198
            .:...|    ||.|..|...|          ||.|.|          ||.:::|         |.
  Fly   123 PINYKK----LQQASLEAAKD----------PAATTA----------RSFKHVD---------SA 154

  Fly   199 EHMDGSSSGNQFILTENTGTFTITQSASSLSKIEADETGTSGAEVDLGDDDVDADLAEDSEEHES 263
            |..|.:        |.:|.:.|:|.|::....:...:......:        :.|..:..::.:.
  Fly   155 ETDDAA--------TNSTTSTTMTTSSAPPLPVNHQQPTVLKRQ--------NPDARQQQQQQQQ 203

  Fly   264 QMID----------EEFAQADPLMELEAGTEMDDDDDVHDQLVD------EEIDDKPRKLGGGKT 312
            |.:.          ::.::|.....|.:.:....:||..|::.:      |:.||          
  Fly   204 QQVQQRPQINGSNAQQPSKATSTNVLGSHSNAPTEDDSGDEVPNNWNAYGEQFDD---------- 258

  Fly   313 RIRRPISAKAVKR-------LSDCK-PTRIQQFAALKREVKD--------DINDALDLAADAVII 361
               ..|||:||..       |...: ..::||...|...|:|        |.|:....|......
  Fly   259 ---CNISAQAVDNKMNVHLSLQQARMQMQLQQQQYLDSNVEDDHNYVAAHDENNDSSFATGVPCG 320

  Fly   362 EGLSLQKAADRFDISKT---VLWRRVRTNPAYMRNNRERPSLQEAYERLKNGHSLKSISSELQIP 423
            .||||....|....:.|   :....:....:|.|..|...||.:|.:.:..|.:.:::|:...||
  Fly   321 SGLSLSLDTDLDTSANTSGGLSHSSIDGYTSYKRVRRSEASLAQAAKCVSKGETFQTVSNMFNIP 385

  Fly   424 MSTLHRHKVRLSAQGRLPNFVSCRKRDNTPKDELRDKLAKAVHACLNEGMSQNHAANL 481
            :||:..:..|   :|.||.    |||                      |...:||.|:
  Fly   386 VSTIRFYMAR---KGILPK----RKR----------------------GRGASHAGNI 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 24/92 (26%)
BTB 35..118 CDD:197585 21/82 (26%)
HTH_psq 348..392 CDD:283007 9/46 (20%)
HTH_psq 458..501 CDD:283007 4/24 (17%)
CG8924NP_573091.1 BTB 25..117 CDD:279045 24/92 (26%)
BTB 34..117 CDD:197585 23/83 (28%)
MerR 378..407 CDD:278788 13/57 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.