DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and Klhl21

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001028524.1 Gene:Klhl21 / 242785 MGIID:1919288 Length:597 Species:Mus musculus


Alignment Length:108 Identity:27/108 - (25%)
Similarity:47/108 - (43%) Gaps:4/108 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 HSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEA-TIMLPD 72
            |:.:::.....||.:.:..:|.|.:..|....||..||:..|...|.:.....|...| .:.|..
Mouse    17 HALSLLRGLSQLRAERKFLDVTLEAAGGRDFPAHRAVLAAASPYFRAMFAGQLRESRAERVRLHG 81

  Fly    73 IRGDLLECMLSFIYMGETSLPSASLPEFLEAINLL---GIKSA 112
            :..|:|:.:|.|.|.|..::...:....|.|.:||   .:|.|
Mouse    82 VPPDMLQLLLDFSYTGRVAVSGDNAEPLLRAADLLQFPAVKEA 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 26/97 (27%)
BTB 35..118 CDD:197585 22/82 (27%)
HTH_psq 348..392 CDD:283007
HTH_psq 458..501 CDD:283007
Klhl21NP_001028524.1 BTB 49..547 CDD:333434 21/76 (28%)
Kelch 1 287..335
KELCH repeat 326..368 CDD:276965
Kelch 2 336..382
KELCH repeat 372..409 CDD:276965
Kelch 3 384..422
KELCH repeat 412..451 CDD:276965
Kelch 4 423..470
Kelch 5 472..512
KELCH repeat 502..548 CDD:276965
Kelch 6 513..560
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 570..597
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.