DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and AgaP_AGAP008959

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_319710.4 Gene:AgaP_AGAP008959 / 1279925 VectorBaseID:AGAP008959 Length:489 Species:Anopheles gambiae


Alignment Length:400 Identity:76/400 - (19%)
Similarity:122/400 - (30%) Gaps:140/400 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AHLFVLSTCSELMRNLLVDVPRGQ-EATIMLPDIRGDLLECMLSFIYMGETSLPSASLPEFLEAI 104
            ||..:|:.||:...:|....|.|. :..:||.....|.:..:|.|:|.||..:...:|..||:|.
Mosquito     5 AHKVILAACSKNFADLFERAPVGTGQICVMLEATSADNMHALLEFMYKGEVHVSQKALESFLKAA 69

  Fly   105 NLLGIK--SAISFEC-------------------------------NPSASP--------PSVDV 128
            ..|.:.  ..|...|                               .||.||        ||..:
Mosquito    70 ENLQVSHTRGIDLRCEDEAVITPAICVCTGQRTHYRARSFASANASQPSQSPFHGPPNDLPSPAI 134

  Fly   129 ---ENHSLA-----------------VESAKS-----------------ITGLQIAEAELLDDEE 156
               :.:||:                 |.||.|                 .||...:.|:.....:
Mosquito   135 RRQQRNSLSSSLESINRAVKRETDSIVGSASSGGNGSSHGSGGGAGAGGATGNAGSGADRGSGND 199

  Fly   157 EPH----------------------------PMVSV-----PATTLAGSQHQPSHSSRSLEYIDV 188
            ..:                            |..|.     |::.|.||......|.||    ..
Mosquito   200 RGNRGNDRGGESGGVGGGGGGGGGGGGGGNTPASSFSPYLQPSSYLPGSYENRKRSLRS----PF 260

  Fly   189 YEPPKITYSIEHMDGSSSGNQFILTENTGTFTITQSASSLSKIEADETGTSGAEVDLGDDDVDAD 253
            ||..:.|......||.:|.........:..:..:.|.||.:..|||...|            |.|
Mosquito   261 YEHQEATRDSVLRDGKASAGNGSPVSGSKNYRPSSSGSSATPTEADTIHT------------DRD 313

  Fly   254 LAEDSEEHESQMIDEEFAQAD-PLMELEAGTEMD-DDDDVHDQLVDEEIDDKPR---KLGGGKTR 313
            ..:.|..:|:..........: |:    :...|| ::.:.|:..||.::..:.|   :.|....|
Mosquito   314 SPQQSNRYENHSPSTTHGHGNGPV----SSNTMDREERNDHNGSVDHKVKHESREGNEAGAEDLR 374

  Fly   314 IR---RPISA 320
            ::   |||.:
Mosquito   375 VKMEMRPIQS 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 21/74 (28%)
BTB 35..118 CDD:197585 23/110 (21%)
HTH_psq 348..392 CDD:283007
HTH_psq 458..501 CDD:283007
AgaP_AGAP008959XP_319710.4 BTB 1..86 CDD:197585 23/80 (29%)
BTB <3..76 CDD:279045 21/70 (30%)
C2H2 Zn finger 437..458 CDD:275368
C2H2 Zn finger 465..482 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.