DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and AgaP_AGAP008506

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_316937.3 Gene:AgaP_AGAP008506 / 1277466 VectorBaseID:AGAP008506 Length:139 Species:Anopheles gambiae


Alignment Length:114 Identity:32/114 - (28%)
Similarity:55/114 - (48%) Gaps:2/114 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WMGHSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATIML 70
            |.|.|..:..:.|:.|::....:|:|.. :|..:.:|..:|::|||:.|.:.::...... .|.|
Mosquito    10 WNGFSEHVSGVFRTFRHEKALQDVILYC-EGQFINSHKLLLASCSEVFRRIFLERANAYH-LIRL 72

  Fly    71 PDIRGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIKSAISFECNP 119
            ...|...:..:|.|||.||.:|....||...:|...|.|||..:...:|
Mosquito    73 VGFRYVDVSLLLDFIYNGEMALSQKQLPSLKQAALKLEIKSLANLVTSP 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 27/92 (29%)
BTB 35..118 CDD:197585 24/82 (29%)
HTH_psq 348..392 CDD:283007
HTH_psq 458..501 CDD:283007
AgaP_AGAP008506XP_316937.3 BTB 21..119 CDD:279045 28/99 (28%)
BTB 32..120 CDD:197585 26/89 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.