DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and AgaP_AGAP011247

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_309398.1 Gene:AgaP_AGAP011247 / 1270680 VectorBaseID:AGAP011247 Length:126 Species:Anopheles gambiae


Alignment Length:107 Identity:36/107 - (33%)
Similarity:58/107 - (54%) Gaps:2/107 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKWMGHSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATI 68
            |||....:.::...|.|||:....:|.||. :|...:||..|||.||...::||.:.| .:...|
Mosquito     9 LKWNDFQTNMVTSFRHLRNEKSFTDVTLAC-EGQTCKAHKMVLSACSPYFKSLLEENP-SKHPII 71

  Fly    69 MLPDIRGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIK 110
            :|.|:..:.|:.:|.|:|.||.::....||.||:..:.|.:|
Mosquito    72 ILKDVSYNHLQAILEFMYAGEVNVSQEQLPTFLKTADRLKVK 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 32/91 (35%)
BTB 35..118 CDD:197585 26/76 (34%)
HTH_psq 348..392 CDD:283007
HTH_psq 458..501 CDD:283007
AgaP_AGAP011247XP_309398.1 BTB_POZ_BAB-like 31..114 CDD:349624 29/85 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23110
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.