DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and KLHL2

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_011529874.1 Gene:KLHL2 / 11275 HGNCID:6353 Length:633 Species:Homo sapiens


Alignment Length:282 Identity:55/282 - (19%)
Similarity:106/282 - (37%) Gaps:81/282 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNHLKWMGHSSTIMDIQ----RSLR--------------------NDNQHCEVVLASRDGVRVRA 41
            ||.|:...||:|...:|    .||:                    :.|..|:|.:.:.| :.:.|
Human    46 MNELRRQSHSATQAGMQWRDLSSLQPPTPGFKRLSHLSLPSSWDYSQNLLCDVTIVAED-MEISA 109

  Fly    42 HLFVLSTCSELMRNLLV-DVPRGQEATIMLPDIRGDLLECMLSFIYMGETS---------LPSAS 96
            |..||:.||.....:.. ::...:...:.:.::.|..|..::.::|..|..         ||:|.
Human   110 HRVVLAACSPYFHAMFTGEMSESRAKRVRIKEVDGWTLRMLIDYVYTAEIQVTEENVQVLLPAAG 174

  Fly    97 L----------PEFLEA----INLLGIKS-AISFECNPSASPPSVDVENH-----------SLAV 135
            |          .||||:    :|.|||:: |....|....:..:...|.|           :|.:
Human   175 LLQLQDVKKTCCEFLESQLHPVNCLGIRAFADMHACTDLLNKANTYAEQHFADVVLSEEFLNLGI 239

  Fly   136 ESAKSITGLQIAEAELLDDEEEPHPMVSVPATTLAGSQH----QPSHSSRSLEYIDVYEPPKITY 196
            |...|:    |:..:|....||     .|....:|...|    :....:|.:|::.:...|: .|
Human   240 EQVCSL----ISSDKLTISSEE-----KVFEAVIAWVNHDKDVRQEFMARLMEHVRLPLLPR-EY 294

  Fly   197 SIEHMD------GSSSGNQFIL 212
            .::.::      .||:...:::
Human   295 LVQRVEEEALVKNSSACKDYLI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 27/137 (20%)
BTB 35..118 CDD:197585 24/107 (22%)
HTH_psq 348..392 CDD:283007
HTH_psq 458..501 CDD:283007
KLHL2XP_011529874.1 GVQW 57..>90 CDD:290611 4/32 (13%)
PHA03098 89..613 CDD:222983 46/239 (19%)
BTB 90..189 CDD:279045 19/99 (19%)
BACK 198..300 CDD:285009 21/111 (19%)
Kelch 351..393 CDD:128874
KELCH repeat 383..426 CDD:276965
Kelch 394..440 CDD:128874
Kelch_1 429..474 CDD:279660
KELCH repeat 430..474 CDD:276965
Kelch 488..536 CDD:128874
KELCH repeat 526..570 CDD:276965
Kelch 537..583 CDD:128874
KELCH repeat 573..619 CDD:276965
Kelch 584..631 CDD:128874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.