DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and ZBTB6

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_006617.1 Gene:ZBTB6 / 10773 HGNCID:16764 Length:424 Species:Homo sapiens


Alignment Length:307 Identity:60/307 - (19%)
Similarity:108/307 - (35%) Gaps:87/307 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HLKWMGHSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRN--LLVDVPRGQE 65
            |.::......::.....||..|..|:|.:...| ...:.|..:|:.||..||:  ||......:.
Human     9 HFQFEQQGDVVLQKMNLLRQQNLFCDVSIYIND-TEFQGHKVILAACSTFMRDQFLLTQSKHVRI 72

  Fly    66 ATIMLPDI-RGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIKSAISFECNPS--------- 120
            ..:...:: |..||.|     |.|...:....|.::|.|.:.|.:...:. :|..:         
Human    73 TILQSAEVGRKLLLSC-----YTGALEVKRKELLKYLTAASYLQMVHIVE-KCTEALSKYLEIDL 131

  Fly   121 -------------ASPPSVDVENHSLAVESAKSITGLQIAEAELLD-----DEEEPHPMVS---- 163
                         :|.|.|..|:.:    |.|....::|:|...::     .|||.:.:.|    
Human   132 SMKNNNQHTDLCQSSDPDVKNEDEN----SDKDCEIIEISEDSPVNIDFHVKEEESNALQSTVES 192

  Fly   164 -----------------------------VPATTLAGSQH----QPSHSSRSLEYIDVYEPPKIT 195
                                         |.:.:.||.::    ||..||::..|....:...|.
Human   193 LTSERKEMKSPELSTVDIGFKDNEICILHVESISTAGVENGQFSQPCTSSKASMYFSETQHSLIN 257

  Fly   196 YSIEHMDGSSSGN--QFILTENT-GTFTITQSASSLSKIEADETGTS 239
            .::|.......||  |.:..||| |::      .::|:|:..|.|.|
Human   258 STVESRVAEVPGNQDQGLFCENTEGSY------GTVSEIQNLEEGYS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 24/95 (25%)
BTB 35..118 CDD:197585 19/85 (22%)
HTH_psq 348..392 CDD:283007
HTH_psq 458..501 CDD:283007
ZBTB6NP_006617.1 BTB_POZ_ZBTB6 8..123 CDD:349506 26/120 (22%)
C2H2 Zn finger 303..323 CDD:275368
zf-C2H2 326..348 CDD:395048
C2H2 Zn finger 328..348 CDD:275368
zf-C2H2_8 331..401 CDD:406359
zf-H2C2_2 340..364 CDD:404364
C2H2 Zn finger 356..376 CDD:275368
C2H2 Zn finger 384..401 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..424
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.