DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and LOC100496285

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_031755220.1 Gene:LOC100496285 / 100496285 -ID:- Length:642 Species:Xenopus tropicalis


Alignment Length:278 Identity:63/278 - (22%)
Similarity:105/278 - (37%) Gaps:83/278 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NHLKWMGHSSTIMDIQRSLRN---DNQHCE--VVLASRDGVRVRAHLFVLSTCSELMRNL----L 57
            |.|....|.|....:.:.||:   ..:.|:  ||..||   |...|..||::.|...|.:    :
 Frog    15 NELSCGDHESVESRVIKGLRDLYLTEELCDTTVVTESR---RFLCHRVVLASVSPYFRAMFSSSM 76

  Fly    58 VDVPRGQEATIMLPDIRGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIKSAISFECNPSAS 122
            .:..||:   ::||||...:::.:|:|||.||.::...::.|.....:.|.| |.:...|   :|
 Frog    77 REAERGE---VVLPDIPPSIMQTVLNFIYTGEATINMDTVQELFTVSSRLQI-SPLQHLC---SS 134

  Fly   123 PPSVDVENHS------LA-VESAKSITGLQI-----------AEAELLD-DEEEPHPMVSVPATT 168
            ..:.::.|.|      || :.:.:|:....|           .|.:.|. |.||..|::|.....
 Frog   135 YLNKELNNDSCFWIYRLAHIHNCRSLLEAAIQYISCHFISLTKEQDFLQLDLEELSPILSSDKLM 199

  Fly   169 LAGSQHQPSHSSRSLEYIDVYE----------------PPKITYSIE----------------HM 201
            ::..             :|||.                |.|:|.:|.                |.
 Frog   200 VSSE-------------LDVYHLALRWWQFNCCSYTSIPEKLTKTIRFHLMSPQELEEVEEEFHK 251

  Fly   202 DGSSSGNQFILTENTGTF 219
            :..||.:||.|....|.|
 Frog   252 ELCSSQHQFSLQLRQGMF 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 29/101 (29%)
BTB 35..118 CDD:197585 22/86 (26%)
HTH_psq 348..392 CDD:283007
HTH_psq 458..501 CDD:283007
LOC100496285XP_031755220.1 PHA03098 57..486 CDD:222983 51/233 (22%)
KELCH repeat 359..403 CDD:276965
KELCH repeat 406..451 CDD:276965
KELCH repeat 545..586 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.