DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15812 and klhl10a

DIOPT Version :9

Sequence 1:NP_523897.2 Gene:CG15812 / 38379 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_017207208.1 Gene:klhl10a / 100333629 ZFINID:ZDB-GENE-131015-1 Length:552 Species:Danio rerio


Alignment Length:180 Identity:40/180 - (22%)
Similarity:62/180 - (34%) Gaps:65/180 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 SDCKPTRIQQFAALKREVKDDINDALDLAADAVIIEGL------------SLQKA------ADRF 373
            ||.....||...|...::.:|....|.:|||.::|.||            |||..      .:||
Zfish    38 SDTMSLIIQHAYARPVQITEDNVCELLVAADQLLISGLTEACCKFLEANFSLQNCIGIWAFTERF 102

  Fly   374 DISKTVLWRRVRTNPAYMRNNRERPSLQEAYERLKNGHSLKSISSE-LQIPMSTLHRHKVRLSAQ 437
            . |.|.|..:.                 |.|. |::...::.:|.| ||:|:..|.         
Zfish   103 H-SCTELHHKA-----------------EFYV-LQHFQEVQQVSEEFLQLPLELLE--------- 139

  Fly   438 GRLPNFVSCRKRDNTPKDELRDKLAKAVHACLNEGMS------QNHAANL 481
                |.:|        :|||..|..:.|...:...::      :||...|
Zfish   140 ----NMIS--------RDELNVKQEEVVFEAILRWINHEPENRRNHITAL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045
BTB 35..118 CDD:197585
HTH_psq 348..392 CDD:283007 15/61 (25%)
HTH_psq 458..501 CDD:283007 5/30 (17%)
klhl10aXP_017207208.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.